PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G140355_P01 | ||||||||
Common Name | ZEAMMB73_553239 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 138aa MW: 15186.9 Da PI: 10.9415 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 47.7 | 3.4e-15 | 55 | 116 | 1 | 62 |
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 +ke +r +r+ +NR++A+ R+RKka++ eLe +vkeLe+ N++L ++l++l++e + l++ GRMZM2G140355_P01 55 DKEHRRLKRLLRNRVSAQQARERKKAYLSELEVRVKELEKRNSELEEKLSTLQNENQMLRQI 116 58899****************************************************99886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PRINTS | PR00041 | 9.7E-5 | 54 | 70 | IPR001630 | cAMP response element binding (CREB) protein |
SMART | SM00338 | 5.8E-15 | 55 | 119 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 3.3E-14 | 56 | 117 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 12.817 | 57 | 120 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 4.6E-17 | 59 | 119 | No hit | No description |
SuperFamily | SSF57959 | 1.94E-13 | 59 | 117 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 62 | 77 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14704 | 1.93E-11 | 69 | 111 | No hit | No description |
PRINTS | PR00041 | 9.7E-5 | 72 | 92 | IPR001630 | cAMP response element binding (CREB) protein |
PRINTS | PR00041 | 9.7E-5 | 92 | 109 | IPR001630 | cAMP response element binding (CREB) protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MESDEEIRRV PEVGLELLTS PSTSGREATA AAAAAGTSSA SQAASASRRG RSPADKEHRR 60 LKRLLRNRVS AQQARERKKA YLSELEVRVK ELEKRNSELE EKLSTLQNEN QMLRQILKNT 120 TVNNRRGPGS SSAGGDSQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2oqq_A | 2e-15 | 80 | 119 | 3 | 42 | Transcription factor HY5 |
2oqq_B | 2e-15 | 80 | 119 | 3 | 42 | Transcription factor HY5 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G140355 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G140355_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK375694 | 3e-66 | AK375694.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3101I12. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008659719.1 | 6e-91 | transcription factor HY5 | ||||
Swissprot | Q9SM50 | 6e-51 | HY5_SOLLC; Transcription factor HY5 | ||||
TrEMBL | A0A3L6DGG9 | 1e-90 | A0A3L6DGG9_MAIZE; Transcription factor HY5 | ||||
TrEMBL | K7VAC7 | 1e-90 | K7VAC7_MAIZE; Putative bZIP transcription factor superfamily protein | ||||
STRING | GRMZM2G140355_P01 | 2e-91 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1408 | 38 | 111 | Representative plant | OGRP2081 | 17 | 37 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11260.1 | 6e-38 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G140355_P01 |
Publications ? help Back to Top | |||
---|---|---|---|
|