PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G11260.1

Common Name

BZIP56, F2I11_150, HY5, TED 5

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bZIP

Protein Properties

Length: 168aa MW: 18463.3 Da PI: 10.194

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G11260.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	51.2	2.8e-16	86	146	1	61
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 eke kr +r+ +NR++A+ R+RKka++ eLe++vk Le++N++L ++l++l++e + l+ AT5G11260.1 86 EKENKRLKRLLRNRVSAQQARERKKAYLSELENRVKDLENKNSELEERLSTLQNENQMLRH 146 7999****************************************************98865 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PRINTS	PR00041	7.2E-7	85	101	IPR001630	cAMP response element binding (CREB) protein
SMART	SM00338	1.5E-14	86	150	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	2.4E-14	86	147	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	12.875	88	151	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	2.1E-17	90	150	No hit	No description
SuperFamily	SSF57959	9.38E-14	90	148	No hit	No description
CDD	cd14704	3.38E-15	91	142	No hit	No description
PROSITE pattern	PS00036	0	93	108	IPR004827	Basic-leucine zipper domain
PRINTS	PR00041	7.2E-7	103	123	IPR001630	cAMP response element binding (CREB) protein
PRINTS	PR00041	7.2E-7	123	140	IPR001630	cAMP response element binding (CREB) protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009585	Biological Process	red, far-red light phototransduction
GO:0009737	Biological Process	response to abscisic acid
GO:0009740	Biological Process	gibberellic acid mediated signaling pathway
GO:0010017	Biological Process	red or far-red light signaling pathway
GO:0010099	Biological Process	regulation of photomorphogenesis
GO:0010114	Biological Process	response to red light
GO:0010218	Biological Process	response to far red light
GO:0010224	Biological Process	response to UV-B
GO:0031539	Biological Process	positive regulation of anthocyanin metabolic process
GO:0042753	Biological Process	positive regulation of circadian rhythm
GO:0080167	Biological Process	response to karrikin
GO:0005634	Cellular Component	nucleus
GO:0000977	Molecular Function	RNA polymerase II regulatory region sequence-specific DNA binding
GO:0003690	Molecular Function	double-stranded DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000005	anatomy	cultured plant cell
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 168 aa Download sequence Send to blast
MQEQATSSLA ASSLPSSSER SSSSAPHLEI KEGIESDEEI RRVPEFGGEA VGKETSGRES 60 GSATGQERTQ ATVGESQRKR GRTPAEKENK RLKRLLRNRV SAQQARERKK AYLSELENRV 120 KDLENKNSEL EERLSTLQNE NQMLRHILKN TTGNKRGGGG GSNADASL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2oqq_A	3e-20	111	150	3	42	Transcription factor HY5
2oqq_B	3e-20	111	150	3	42	Transcription factor HY5
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.20257	0.0	flower\| inflorescence\| leaf\| root\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	186522097	0.0
Genevisible	250420_at	0.0
Expression Atlas	AT5G11260	-
AtGenExpress	AT5G11260	-
ATTED-II	AT5G11260	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in root, hypocotyl, cotyledon, leaf, stem and floral organs.

Functional Description ? help Back to Top
Source	Description
TAIR	Basic leucine zipper (bZIP) transcription factor. Nuclear localization. Involved in light-regulated transcriptional activation of G-box-containing promoters. Negatively regulated by Cop1. Although cytokinins do not appear to affect the gene's promoter activity, they appear to stabilize the protein. HY5 plays a role in anthocyanin accumulation in far-red light and blue light, but not in red light or in the dark. Mutant studies showed that the gene product is involved in the positive regulation of the PHYA-mediated inhibition of hypocotyl elongation. Binds to G- and Z-boxes, and other ACEs, but not to E-box. Loss of function mutation shows ABA resistant seedling phenotypes suggesting involvement for HY5 in mediating ABA responses. Binds to the promoter of ABI5 and regulates its expression.
UniProt	Transcription factor that promotes photomorphogenesis in light. Acts downstream of the light receptor network and directly affects transcription of light-induced genes. Specifically involved in the blue light specific pathway, suggesting that it participates in transmission of cryptochromes (CRY1 and CRY2) signals to downstream responses. In darkness, its degradation prevents the activation of light-induced genes (Probable). Acts coordinately with SPL7 to regulate the microRNA miR408 and its target genes in response to changes in light and copper conditions (PubMed:25516599). Regulates the abscisic acid (ABA) signaling pathway. Also involved in root gravitropism (PubMed:26474641). {ECO:0000269\|PubMed:25516599, ECO:0000269\|PubMed:26474641, ECO:0000305}.

Function -- GeneRIF ? help Back to Top
the first structural and biophysical characterization of HY5 is reported here. [PMID: 17001643] The data support the hypothesis that the opposite root system phenotypes of hy5 single and hy5 hyh double mutants represent the morphological response to a quantitative gradient in the same molecular process. [PMID: 17121469] HY5 is a high hierarchical regulator of the transcriptional cascades for photomorphogenesis. [PMID: 17337630] necessary for high nitrate reductase expression in far-red light [PMID: 17929051] Gibberellins signaling regulates protein stability of HY5, and the activity of PIF3. [PMID: 18053005] This research provides evidence that, in ultraviolet B (UV-B) signaling, UVR8, HY5, and HYH act together and demonstrates a new role for HYH in UV-B responses. [PMID: 18055587] Data show that at part of the remodeling of light signaling networks involves converting HY5, a positive regulator of PhANGs, into a negative regulator of PhANGs. [PMID: 18065688] Arabidopsis HY5 functions as a novel DNA-binding tag (DBtag) for proteins. We also demonstrate that the DBtagged proteins could be immobilized and purified on a newly designed agarose/DNA microplate [PMID: 18082144] The isolation and characterization of light-regulated zinc finger protein 1 (LZF1), a HY5-regulated factor, is reported. [PMID: 18182030] Data show that there is a concerted function of CAM7 and HY5 basic leucine zipper transcription factor in Arabidopsis seedling development. [PMID: 18621945] HY5 and HYH were activators of NIA2, but inhibitors of NRT1.1 when tested across various light treatments and tissue types. [PMID: 19540016] action spectrum for the induction of HY5 by the UVR8 pathway showed a main peak at 280 nm with a smaller peak at 300 nm [PMID: 19558421] HY5 is required for the transcriptional activation of the PFG1/MYB12 and PFG3/MYB111 genes under UV-B and visible light. [PMID: 19895401] Det1 esp1 spa1 double mutant showed higher HY5 protein levels than either single mutant or the wild type. [PMID: 20041285] Data show that phosphorylation-mimicking serine substitutions strongly interfere with the DNA binding of two prototypical Arabidopsis bZIPs, namely AtZIP63 and HY5. [PMID: 20047775] HY5 directly binds to C/G-box and G-box in the HTL promoter and regulates the expression of HTL. [PMID: 20864454] HY5 and HYH are two necessary regulators that play a pivotal role during low temperature-induced anthocyanin accumulation in Arabidopsis seedlings. [PMID: 20932601] Data show that HY5 plays a role in negative feedback regulation of phyA signaling by attenuating FHY3/FAR1-activated FHY1/FHL expression, providing a mechanism for fine-tuning phyA signaling homeostasis. [PMID: 21097709] HY5 binds to over 9000 genes, detectably affecting the expression of over 1100 genes, either positively or negatively. HY5 indirectly regulate many other genes through sub-networks mediated by other regulators. [PMID: 21265889] The genetic interaction between HY5 and FRY1 indicates that HY5 and FRY1 may act in overlapping pathways that mediate light signaling and lateral root development. [PMID: 21301222] Analysis of BBX22 degradation kinetics shows that it has a short half-life under both dark and light conditions. COP1 mediates the BBX22 degradation in the dark. Although dispensable in the dark, HY5 contributes to the BBX22 degradation in the light. [PMID: 21427283] HY5 plays an important role in regulation of APR1 and APR2 gene expression and plant sulfate assimilation [PMID: 21623972] BBX32 interacts with SALT TOLERANCE HOMOLOG2/BBX21, another B-box protein previously shown to interact with HY5. [PMID: 21632973] Together with HY5/HYH, gibberellins signaling may play an important role during low temperature-induced anthocyanin accumulation. [PMID: 21636970] The HY5-AtERF11 regulon is a key factor modulating abscisic acid-regulated ethylene biosynthesis. [PMID: 21645149] light triggers MSBP1 expression through direct binding to and activation by HY5 and HYH. [PMID: 21715650] HY5 represses the expression of PKS4 and auxin-related genes. [PMID: 21848684] HSP90 proteins respond to the tetrapyrrole-mediated plastid signal to control expression of photosynthesis-associated nuclear genes [PMID: 22201048] HY5 and BBX24 act antagonistically in UV-B response. [PMID: 22410790] HY1 and HY5 additively regulate the expression of light regulated genes and accumulation of chlorophyll and anthocyanin during early seedling development. [PMID: 22424472] the functional interrelations of GBF1 with HY5 and HYH in Arabidopsis seedling development. [PMID: 22692212] Mediator component cooperates with COP1 in the regulation of light responses and that the hypersensitive seedling phenotype strictly depends on the presence of HY5, an important positive regulator of light-dependent gene expression. [PMID: 22760208] KAI2 and MAX2 define a regulatory pathway that largely operates independently of HY5 to mediate seedling responses to abiotic signals such as smoke and light. [PMID: 23142794] COP1 gene expression in response to photomorphogenic UV-B is controlled by a combinatorial regulation of FHY3 and HY5, and this UV-B-specific working mode of FHY3 and HY5 is distinct from that in far-red light and circadian conditions. [PMID: 23150635] PKL physically interacts with HY5 to directly regulate hypocotyl cell elongation by repressing trimethylation of histone H3 Lys 27 (H3K27me3) on the regulatory regions of several cell elongation- related genes in response to changing light conditions. [PMID: 23314848] HY5 transmits phyA signals through an FHY1/FHL-independent pathway but it may also modulate FHY1/FHL signal through its interaction with HFR1 and LAF1. [PMID: 23503597] Bifurcate regulation of anthocyanin biosynthesis by HY5 via transcriptional activation of PAP1. [PMID: 23583450] Data suggest that BBX25 (At2g31380) and BBX24 (At1g06040) function as transcriptional corepressors, probably by forming inactive heterodimers with HY5 (At5g11260) downregulating BBX22 (AT1G78600) expression for the light-mediated seedling development. [PMID: 23624715] Data indicate that the PIF1/PIF3-HY5/HYH transcriptional modules mediate crosstalk between light and ROS signaling and a mechanism by which plants adapt to the light environments. [PMID: 23645630] The DNA binding activity of GBF1 is modulated by heterodimeriation with HY5 and HYH. [PMID: 24157608] our investigation demonstrates that the COP1-HY5 complex is a novel integrator that plays an essential role in ethylene-promoted hypocotyl growth in the light [PMID: 24348273] COP1 inactivation involved in rapid light-induced responses were compared to that of nuclear HY5. [PMID: 24434030] A possible interplay between PFT1 and another transcription factor, HY5, may regulate induction of APS reductase expression by light. [PMID: 24583010] results demonstrate that CAM7 and HY5 directly interact with the HY5 promoter to mediate the transcriptional activity of HY5 during Arabidopsis seedling development [PMID: 24610722] by directly targeting a common promoter cis-element (G-box), HY5 and PIFs form a dynamic activation-suppression transcriptional module responsive to light and temperature cues. [PMID: 24922306] Ultraviolet-B causes unilateral accumulation of HY5, which then, in the end, leads to bending toward the light. [PMID: 25096978] Compromised activity of HY5 may have been mainly responsible for the partial reversal of the det1 phenotype in ted3 det1. [PMID: 25248106] Data indicate that the bZIP transcription factor ELONGATED HYPOCOTYL5 (HY5) is enriched at target promoters in response to UV-B in a UV RESISTANCE LOCUS8 (UVR8) photoreceptor-dependent manner. [PMID: 25351492] Investigated the root phenotype of cam7 hy5 double mutants and showed that CAM7 and HY5 genetically interact to control the root growth. We have further shown an interdependent function of HY5 and CAM7 in abscisic acid responsiveness. [PMID: 25763709] HY5 positively regulates nitrite reductase gene NIR1 and negatively regulates the ammonium transporter gene AMT1;2 under all nitrogen and light conditions tested. [PMID: 26259199] the physical connection between brassinosteroid and light signaling pathways in regulating cotyledon opening in Arabidopsis is mediated by a direct interaction between BZR1 and HY5 [PMID: 26363272] Data indicate a coordinated regulation of Arabidopsis proteins SHW1, COP1, and HY5 in seedling development. [PMID: 26474641] This study showed that HY5 directly binds to the MYBD promoter and that although MYBD and MYBH are homologs, they act in opposite ways during plant photomorphogenesis. [PMID: 26576746] light affected TCP2 expression in a wavelength-dependent manner and TCP2 positively regulates mRNA expression of HYH and HY5. [PMID: 26596765] Arabidopsis ELONGATED HYPOCOTYL5 (HY5) is a shoot-to-root mobile signal that mediates light promotion of root growth and nitrate uptake. Shoot-derived HY5 auto-activates root HY5 and also promotes root nitrate uptake by activating NRT2.1, a gene encoding a high-affinity nitrate transporter. [PMID: 26877080] ABI4 and HY5 antagonistically regulate the expression of CONSTITUTIVE PHOTOMORPHOGENIC1 (COP1) and the subsequent greening process. In turn, ABI4 and HY5 are targeted for degradation by COP1 in the light and dark, respectively, to ensure a proper interplay of ABI4 and HY5 actions during seedling de-etiolation. [PMID: 27255835] BBX21 binds to the T/G-box in the HY5 promoter and directly activates HY5 expression in the light. [PMID: 27325768] Repression of MYBL2 by Both microRNA858a and HY5 Leads to the Activation of Anthocyanin Biosynthetic Pathway in Arabidopsis [PMID: 27450422] BZS1 interacts with HY5 and plays a central role in integrating light and multiple hormone signals for photomorphogenesis in Arabidopsis [PMID: 27523280] light regulates salt-induced transcriptional memory via the function of HY5 in maintaining H3K4me3 level at the memory gene; salt-induced transcriptional memory of P5CS1 is associated with the retention of increased H3K4me3 level at P5CS1 during the recovery stage [PMID: 27930298] These findings reveal a mechanistic framework in which DET1/COP1 and HY5 regulatory modules act independently to regulate growth through the environmental signal integrator PIF4. [PMID: 28076780] Results suggest that light increases the endoplasmic reticulum stress sensitivity of plants and ELONGATED HYPOCOTYL 5, a positive regulator of light signaling, negatively regulates unfolded protein response gene expression in plant cells. [PMID: 28167764] Prefoldins Negatively Regulate Cold Acclimation in Arabidopsis thaliana by Promoting Nuclear Proteasome-Mediated HY5 Degradation [PMID: 28412546] It has been reported that HY5 regulates HYH expression in roots and contributes to root growth under different light conditions. [PMID: 28683099] the transcriptional cascade consisting of PIF1/PIF3, HY5, and BBX23 controls photomorphogenesis. [PMID: 28687557] HY5 regulates lateral root emergence by decreasing the plasma membrane abundance of PIN-FORMED3 and LIKE-AUX1 3 auxin transporters. [PMID: 29321188] These results indicate that WRKY36 is a negative regulator of HY5 and that UVB represses WRKY36 via UVR8 to promote the transcription of HY5 and photomorphogenesis. The UVR8-WRKY36 interaction in the nucleus represents a novel mechanism of early UVR8 signal transduction in Arabidopsis. [PMID: 29379156] Findings indicate that both B-Box Proteins BBX21 and BBX24 regulate ELONGATED HYPOCOTYL 5 protein (HY5) activity post-transcriptionally, in opposite ways. [PMID: 29439209] Expression levels of phosphate starvation-responsive genes are directly modulated by phytochrome interacting factors (PIF) PIF4/PIF5 and HY5 transcription factors whose activity is under the control of phytochromes. [PMID: 30518831] Genetic analyses reveal that RSM1 mediates multiple functions of HY5 in responses of seed germination, post-germination development to ABA and abiotic stresses, and seedling tolerance to salinity. Pull-down and BiFC assays show that RSM1 interacts with HY5/HYH in vitro and in vivo. RSM1 and HY5/HYH may function as a regulatory module in responses to ABA and abiotic stresses. [PMID: 30566447]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00117	ampDAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G11260.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G12110(R), AT1G12370(A), AT1G29920(A), AT1G29930(A), AT1G37130(A), AT1G58290(A), AT1G67090(A), AT1G78600(A), AT2G36270(A), AT2G37678(R), AT2G40080(A), AT2G47460(A), AT3G22840(A), AT3G23050(A), AT4G14550(A), AT4G15480(A), AT4G22880(A), AT4G32880(A), AT5G02200(R), AT5G13930(A), AT5G42800(A), ATCG00270(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, gibberellin

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G11260, AT5G18450, AT5G19790, AT5G21960, AT5G46760, AT5G48560, AT5G57150, AT1G09530, AT1G25330, AT1G02340, AT1G56650, AT1G73870, AT1G75080, AT1G75540
IntAct	Search O24646

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G11260

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB005295	0.0	AB005295.1 Arabidopsis thaliana mRNA for HY5, complete cds.
GenBank	AB005456	0.0	AB005456.1 Arabidopsis thaliana mRNA for HY5, complete cds.
GenBank	AK229362	0.0	AK229362.1 Arabidopsis thaliana mRNA for bZip transcription factor HY5 / AtbZip56, complete cds, clone: RAFL16-60-N08.
GenBank	BT025519	0.0	BT025519.1 Arabidopsis thaliana At5g11260 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_568246.1	1e-115	Basic-leucine zipper (bZIP) transcription factor family protein
Swissprot	O24646	1e-116	HY5_ARATH; Transcription factor HY5
TrEMBL	A0A384KAH1	1e-113	A0A384KAH1_ARATH; TED 5
TrEMBL	Q1H5E5	1e-113	Q1H5E5_ARATH; At5g11260
STRING	AT5G11260.1	1e-114	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM5691	27	49
Representative plant	OGRP2081	17	37

Link Out ? help Back to Top
Phytozome	AT5G11260.1
Entrez Gene	830996
iHOP	AT5G11260
wikigenes	AT5G11260

Publications ? help Back to Top
Yamaguchi R,Nakamura M,Mochizuki N,Kay SA,Nagatani A Light-dependent translocation of a phytochrome B-GFP fusion protein to the nucleus in transgenic Arabidopsis. J. Cell Biol., 1999. 145(3): p. 437-45 [PMID:10225946] Cao D,Lin Y,Cheng CL Genetic interactions between the chlorate-resistant mutant cr 8 8 and the photomorphogenic mutants cop1 and hy5. Plant Cell, 2000. 12(2): p. 199-210 [PMID:10662857] Osterlund MT,Hardtke CS,Wei N,Deng XW Targeted destabilization of HY5 during light-regulated development of Arabidopsis. Nature, 2000. 405(6785): p. 462-6 [PMID:10839542] Hardtke CS, et al. HY5 stability and activity in arabidopsis is regulated by phosphorylation in its COP1 binding domain. EMBO J., 2000. 19(18): p. 4997-5006 [PMID:10990463] Riechmann JL,Ratcliffe OJ A genomic perspective on plant transcription factors. Curr. Opin. Plant Biol., 2000. 3(5): p. 423-34 [PMID:11019812] Osterlund MT,Wei N,Deng XW The roles of photoreceptor systems and the COP1-targeted destabilization of HY5 in light control of Arabidopsis seedling development. Plant Physiol., 2000. 124(4): p. 1520-4 [PMID:11115869] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Schwechheimer C,Deng XW The COP/DET/FUS proteins-regulators of eukaryotic growth and development. Semin. Cell Dev. Biol., 2000. 11(6): p. 495-503 [PMID:11145879] Guo H,Mockler T,Duong H,Lin C SUB1, an Arabidopsis Ca2+-binding protein involved in cryptochrome and phytochrome coaction. Science, 2001. 291(5503): p. 487-90 [PMID:11161203] Holm M,Hardtke CS,Gaudet R,Deng XW Identification of a structural motif that confers specific interaction with the WD40 repeat domain of Arabidopsis COP1. EMBO J., 2001. 20(1-2): p. 118-27 [PMID:11226162] Baima S, et al. The arabidopsis ATHB-8 HD-zip protein acts as a differentiation-promoting transcription factor of the vascular meristems. Plant Physiol., 2001. 126(2): p. 643-55 [PMID:11402194] Wang H,Ma LG,Li JM,Zhao HY,Deng XW Direct interaction of Arabidopsis cryptochromes with COP1 in light control development. Science, 2001. 294(5540): p. 154-8 [PMID:11509693] Pepper AE, et al. shl, a New set of Arabidopsis mutants with exaggerated developmental responses to available red, far-red, and blue light. Plant Physiol., 2001. 127(1): p. 295-304 [PMID:11553757] Peng Z,Serino G,Deng XW A role of Arabidopsis COP9 signalosome in multifaceted developmental processes revealed by the characterization of its subunit 3. Development, 2001. 128(21): p. 4277-88 [PMID:11684663] Harari-Steinberg O,Ohad I,Chamovitz DA Dissection of the light signal transduction pathways regulating the two early light-induced protein genes in Arabidopsis. Plant Physiol., 2001. 127(3): p. 986-97 [PMID:11706180] Thum KE,Kim M,Christopher DA,Mullet JE Cryptochrome 1, cryptochrome 2, and phytochrome a co-activate the chloroplast psbD blue light-responsive promoter. Plant Cell, 2001. 13(12): p. 2747-60 [PMID:11752385] Malec P,Yahalom A,Chamovitz DA Identification of a light-regulated protein kinase activity from seedlings of Arabidopsis thaliana. Photochem. Photobiol., 2002. 75(2): p. 178-83 [PMID:11883605] Jakoby M, et al. bZIP transcription factors in Arabidopsis. Trends Plant Sci., 2002. 7(3): p. 106-11 [PMID:11906833] Oyama T,Shimura Y,Okada K The IRE gene encodes a protein kinase homologue and modulates root hair growth in Arabidopsis. Plant J., 2002. 30(3): p. 289-99 [PMID:12000677] Holm M,Ma LG,Qu LJ,Deng XW Two interacting bZIP proteins are direct targets of COP1-mediated control of light-dependent gene expression in Arabidopsis. Genes Dev., 2002. 16(10): p. 1247-59 [PMID:12023303] Hardtke CS,Okamoto H,Stoop-Myer C,Deng XW Biochemical evidence for ubiquitin ligase activity of the Arabidopsis COP1 interacting protein 8 (CIP8). Plant J., 2002. 30(4): p. 385-94 [PMID:12028569] Kim YM,Woo JC,Song PS,Soh MS HFR1, a phytochrome A-signalling component, acts in a separate pathway from HY5, downstream of COP1 in Arabidopsis thaliana. Plant J., 2002. 30(6): p. 711-9 [PMID:12061902] Yadav V, et al. Light regulated modulation of Z-box containing promoters by photoreceptors and downstream regulatory components, COP1 and HY5, in Arabidopsis. Plant J., 2002. 31(6): p. 741-53 [PMID:12220265] Benvenuto G,Formiggini F,Laflamme P,Malakhov M,Bowler C The photomorphogenesis regulator DET1 binds the amino-terminal tail of histone H2B in a nucleosome context. Curr. Biol., 2002. 12(17): p. 1529-34 [PMID:12225670] Somers DE,Sharrock RA,Tepperman JM,Quail PH The hy3 Long Hypocotyl Mutant of Arabidopsis Is Deficient in Phytochrome B. Plant Cell, 1991. 3(12): p. 1263-1274 [PMID:12324590] Ma L, et al. Genomic evidence for COP1 as a repressor of light-regulated gene expression and development in Arabidopsis. Plant Cell, 2002. 14(10): p. 2383-98 [PMID:12368493] Schwechheimer C,Serino G,Deng XW Multiple ubiquitin ligase-mediated processes require COP9 signalosome and AXR1 function. Plant Cell, 2002. 14(10): p. 2553-63 [PMID:12368504] Nishimura R,Ohmori M,Fujita H,Kawaguchi M A Lotus basic leucine zipper protein with a RING-finger motif negatively regulates the developmental program of nodulation. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(23): p. 15206-10 [PMID:12397181] McCormac AC,Terry MJ Light-signalling pathways leading to the co-ordinated expression of HEMA1 and Lhcb during chloroplast development in Arabidopsis thaliana. Plant J., 2002. 32(4): p. 549-59 [PMID:12445126] Maxwell BB,Andersson CR,Poole DS,Kay SA,Chory J HY5, Circadian Clock-Associated 1, and a cis-element, DET1 dark response element, mediate DET1 regulation of chlorophyll a/b-binding protein 2 expression. Plant Physiol., 2003. 133(4): p. 1565-77 [PMID:14563928] Saijo Y, et al. The COP1-SPA1 interaction defines a critical step in phytochrome A-mediated regulation of HY5 activity. Genes Dev., 2003. 17(21): p. 2642-7 [PMID:14597662] Yang KY,Kim YM,Lee S,Song PS,Soh MS Overexpression of a mutant basic helix-loop-helix protein HFR1, HFR1-deltaN105, activates a branch pathway of light signaling in Arabidopsis. Plant Physiol., 2003. 133(4): p. 1630-42 [PMID:14645731] Ulm R, et al. Genome-wide analysis of gene expression reveals function of the bZIP transcription factor HY5 in the UV-B response of Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2004. 101(5): p. 1397-402 [PMID:14739338] Cluis CP,Mouchel CF,Hardtke CS The Arabidopsis transcription factor HY5 integrates light and hormone signaling pathways. Plant J., 2004. 38(2): p. 332-47 [PMID:15078335] Bertrand C, et al. Arabidopsis HAF2 gene encoding TATA-binding protein (TBP)-associated factor TAF1, is required to integrate light signals to regulate gene expression and growth. J. Biol. Chem., 2005. 280(2): p. 1465-73 [PMID:15525647] Jang IC,Yang JY,Seo HS,Chua NH HFR1 is targeted by COP1 E3 ligase for post-translational proteolysis during phytochrome A signaling. Genes Dev., 2005. 19(5): p. 593-602 [PMID:15741320] Yang J, et al. Repression of light signaling by Arabidopsis SPA1 involves post-translational regulation of HFR1 protein accumulation. Plant J., 2005. 43(1): p. 131-41 [PMID:15960622] Brown BA, et al. A UV-B-specific signaling component orchestrates plant UV protection. Proc. Natl. Acad. Sci. U.S.A., 2005. 102(50): p. 18225-30 [PMID:16330762] Roig-Villanova I,Bou J,Sorin C,Devlin PF,Martínez-García JF Identification of primary target genes of phytochrome signaling. Early transcriptional control during shade avoidance responses in Arabidopsis. Plant Physiol., 2006. 141(1): p. 85-96 [PMID:16565297] Yang J,Wang H The central coiled-coil domain and carboxyl-terminal WD-repeat domain of Arabidopsis SPA1 are responsible for mediating repression of light signaling. Plant J., 2006. 47(4): p. 564-76 [PMID:16813572] Heddad M, et al. Differential expression and localization of early light-induced proteins in Arabidopsis. Plant Physiol., 2006. 142(1): p. 75-87 [PMID:16829586] Oravecz A, et al. CONSTITUTIVELY PHOTOMORPHOGENIC1 is required for the UV-B response in Arabidopsis. Plant Cell, 2006. 18(8): p. 1975-90 [PMID:16829591] Khanna R, et al. Functional profiling reveals that only a small number of phytochrome-regulated early-response genes in Arabidopsis are necessary for optimal deetiolation. Plant Cell, 2006. 18(9): p. 2157-71 [PMID:16891401] Molas ML,Kiss JZ,Correll MJ Gene profiling of the red light signalling pathways in roots. J. Exp. Bot., 2006. 57(12): p. 3217-29 [PMID:16908503] Subramanian C, et al. A suite of tools and application notes for in vivo protein interaction assays using bioluminescence resonance energy transfer (BRET). Plant J., 2006. 48(1): p. 138-52 [PMID:16925598] Yoon MK,Shin J,Choi G,Choi BS Intrinsically unstructured N-terminal domain of bZIP transcription factor HY5. Proteins, 2006. 65(4): p. 856-66 [PMID:17001643] Tepperman JM,Hwang YS,Quail PH phyA dominates in transduction of red-light signals to rapidly responding genes at the initiation of Arabidopsis seedling de-etiolation. Plant J., 2006. 48(5): p. 728-42 [PMID:17076805] Sibout R, et al. Opposite root growth phenotypes of hy5 versus hy5 hyh mutants correlate with increased constitutive auxin signaling. PLoS Genet., 2006. 2(11): p. e202 [PMID:17121469] Vandenbussche F, et al. HY5 is a point of convergence between cryptochrome and cytokinin signalling pathways in Arabidopsis thaliana. Plant J., 2007. 49(3): p. 428-41 [PMID:17217468] Yoon MK,Kim HM,Choi G,Lee JO,Choi BS Structural basis for the conformational integrity of the Arabidopsis thaliana HY5 leucine zipper homodimer. J. Biol. Chem., 2007. 282(17): p. 12989-3002 [PMID:17261584] Shin J,Park E,Choi G PIF3 regulates anthocyanin biosynthesis in an HY5-dependent manner with both factors directly binding anthocyanin biosynthetic gene promoters in Arabidopsis. Plant J., 2007. 49(6): p. 981-94 [PMID:17319847] Lee J, et al. Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development. Plant Cell, 2007. 19(3): p. 731-49 [PMID:17337630] Salisbury FJ,Hall A,Grierson CS,Halliday KJ Phytochrome coordinates Arabidopsis shoot and root development. Plant J., 2007. 50(3): p. 429-38 [PMID:17419844] Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance. Plant Physiol., 2007. 144(3): p. 1391-406 [PMID:17478635] Kaiserli E,Jenkins GI UV-B promotes rapid nuclear translocation of the Arabidopsis UV-B specific signaling component UVR8 and activates its function in the nucleus. Plant Cell, 2007. 19(8): p. 2662-73 [PMID:17720867] Jonassen EM,Lea US,Lillo C HY5 and HYH are positive regulators of nitrate reductase in seedlings and rosette stage plants. Planta, 2008. 227(3): p. 559-64 [PMID:17929051] Datta S,Hettiarachchi C,Johansson H,Holm M SALT TOLERANCE HOMOLOG2, a B-box protein in Arabidopsis that activates transcription and positively regulates light-mediated development. Plant Cell, 2007. 19(10): p. 3242-55 [PMID:17965270] Alabadí D, et al. Gibberellins modulate light signaling pathways to prevent Arabidopsis seedling de-etiolation in darkness. Plant J., 2008. 53(2): p. 324-35 [PMID:18053005] Brown BA,Jenkins GI UV-B signaling pathways with different fluence-rate response profiles are distinguished in mature Arabidopsis leaf tissue by requirement for UVR8, HY5, and HYH. Plant Physiol., 2008. 146(2): p. 576-88 [PMID:18055587] Ruckle ME,DeMarco SM,Larkin RM Plastid signals remodel light signaling networks and are essential for efficient chloroplast biogenesis in Arabidopsis. Plant Cell, 2007. 19(12): p. 3944-60 [PMID:18065688] Sawasaki T, et al. Arabidopsis HY5 protein functions as a DNA-binding tag for purification and functional immobilization of proteins on agarose/DNA microplate. FEBS Lett., 2008. 582(2): p. 221-8 [PMID:18082144] Chang CS, et al. LZF1, a HY5-regulated transcriptional factor, functions in Arabidopsis de-etiolation. Plant J., 2008. 54(2): p. 205-19 [PMID:18182030] Desai M,Hu J Light induces peroxisome proliferation in Arabidopsis seedlings through the photoreceptor phytochrome A, the transcription factor HY5 HOMOLOG, and the peroxisomal protein PEROXIN11b. Plant Physiol., 2008. 146(3): p. 1117-27 [PMID:18203870] Safrany J, et al. Identification of a novel cis-regulatory element for UV-B-induced transcription in Arabidopsis. Plant J., 2008. 54(3): p. 402-14 [PMID:18266923] Song YH, et al. DNA-binding study identifies C-box and hybrid C/G-box or C/A-box motifs as high-affinity binding sites for STF1 and LONG HYPOCOTYL5 proteins. Plant Physiol., 2008. 146(4): p. 1862-77 [PMID:18287490] Chen H, et al. Integration of light and abscisic acid signaling during seed germination and early seedling development. Proc. Natl. Acad. Sci. U.S.A., 2008. 105(11): p. 4495-500 [PMID:18332440] de la Fuente van Bentem S, et al. Site-specific phosphorylation profiling of Arabidopsis proteins by mass spectrometry and peptide chip analysis. J. Proteome Res., 2008. 7(6): p. 2458-70 [PMID:18433157] Lee Y,Kim MH,Kim SK,Kim SH Phytochrome-mediated differential gene expression of plant Ran/TC4 small G-proteins. Planta, 2008. 228(1): p. 215-24 [PMID:18481083] Kumagai T, et al. The common function of a novel subfamily of B-Box zinc finger proteins with reference to circadian-associated events in Arabidopsis thaliana. Biosci. Biotechnol. Biochem., 2008. 72(6): p. 1539-49 [PMID:18540109] Kushwaha R,Singh A,Chattopadhyay S Calmodulin7 plays an important role as transcriptional regulator in Arabidopsis seedling development. Plant Cell, 2008. 20(7): p. 1747-59 [PMID:18621945] Lillo C Signalling cascades integrating light-enhanced nitrate metabolism. Biochem. J., 2008. 415(1): p. 11-9 [PMID:18778247] Datta S, et al. LZF1/SALT TOLERANCE HOMOLOG3, an Arabidopsis B-box protein involved in light-dependent development and gene expression, undergoes COP1-mediated ubiquitination. Plant Cell, 2008. 20(9): p. 2324-38 [PMID:18796637] Ruckle ME,Larkin RM Plastid signals that affect photomorphogenesis in Arabidopsis thaliana are dependent on GENOMES UNCOUPLED 1 and cryptochrome 1. New Phytol., 2009. 182(2): p. 367-79 [PMID:19140931] Harris SR, et al. Effect of magnetic fields on cryptochrome-dependent responses in Arabidopsis thaliana. J R Soc Interface, 2009. 6(41): p. 1193-205 [PMID:19324677] Weller JL,Hecht V,Vander Schoor JK,Davidson SE,Ross JJ Light regulation of gibberellin biosynthesis in pea is mediated through the COP1/HY5 pathway. Plant Cell, 2009. 21(3): p. 800-13 [PMID:19329557] Li JF,Park E,von Arnim AG,Nebenf The FAST technique: a simplified Agrobacterium-based transformation method for transient gene expression analysis in seedlings of Arabidopsis and other plant species. Plant Methods, 2009. 5: p. 6 [PMID:19457242] Jiang L,Wang Y,Bj Arabidopsis radical-induced cell death1 is involved in UV-B signaling. Photochem. Photobiol. Sci., 2009. 8(6): p. 838-46 [PMID:19492112] Jonassen EM,Sévin DC,Lillo C The bZIP transcription factors HY5 and HYH are positive regulators of the main nitrate reductase gene in Arabidopsis leaves, NIA2, but negative regulators of the nitrate uptake gene NRT1.1. J. Plant Physiol., 2009. 166(18): p. 2071-6 [PMID:19540016] Brown BA,Headland LR,Jenkins GI UV-B action spectrum for UVR8-mediated HY5 transcript accumulation in Arabidopsis. Photochem. Photobiol., 2009 Sep-Oct. 85(5): p. 1147-55 [PMID:19558421] Sellaro R,Hoecker U,Yanovsky M,Chory J,Casal JJ Synergism of red and blue light in the control of Arabidopsis gene expression and development. Curr. Biol., 2009. 19(14): p. 1216-20 [PMID:19559617] Datta S,Johansson H,Hettiarachchi C,Holm M STH2 has 2 B there: An insight into the role of B-box containing proteins in Arabidopsis. Plant Signal Behav, 2008. 3(8): p. 547-8 [PMID:19704462] Kaur N,Hu J Dynamics of peroxisome abundance: a tale of division and proliferation. Curr. Opin. Plant Biol., 2009. 12(6): p. 781-8 [PMID:19734083] Gong W, et al. The development of protein microarrays and their applications in DNA-protein and protein-protein interaction analyses of Arabidopsis transcription factors. Mol Plant, 2008. 1(1): p. 27-41 [PMID:19802365] Stracke R, et al. The Arabidopsis bZIP transcription factor HY5 regulates expression of the PFG1/MYB12 gene in response to light and ultraviolet-B radiation. Plant Cell Environ., 2010. 33(1): p. 88-103 [PMID:19895401] Rubin G,Tohge T,Matsuda F,Saito K,Scheible WR Members of the LBD family of transcription factors repress anthocyanin synthesis and affect additional nitrogen responses in Arabidopsis. Plant Cell, 2009. 21(11): p. 3567-84 [PMID:19933203] Charron JB,He H,Elling AA,Deng XW Dynamic landscapes of four histone modifications during deetiolation in Arabidopsis. Plant Cell, 2009. 21(12): p. 3732-48 [PMID:20008096] Jonassen EM,Sandsmark BA,Lillo C Unique status of NIA2 in nitrate assimilation: NIA2 expression is promoted by HY5/HYH and inhibited by PIF4. Plant Signal Behav, 2009. 4(11): p. 1084-6 [PMID:20009559] Andronis C,Barak S,Knowles SM,Sugano S,Tobin EM The clock protein CCA1 and the bZIP transcription factor HY5 physically interact to regulate gene expression in Arabidopsis. Mol Plant, 2008. 1(1): p. 58-67 [PMID:20031914] Cloix C,Jenkins GI Interaction of the Arabidopsis UV-B-specific signaling component UVR8 with chromatin. Mol Plant, 2008. 1(1): p. 118-28 [PMID:20031919] Nixdorf M,Hoecker U SPA1 and DET1 act together to control photomorphogenesis throughout plant development. Planta, 2010. 231(4): p. 825-33 [PMID:20041285] Kirchler T, et al. The role of phosphorylatable serine residues in the DNA-binding domain of Arabidopsis bZIP transcription factors. Eur. J. Cell Biol., 2010 Feb-Mar. 89(2-3): p. 175-83 [PMID:20047775] Nelson DC, et al. Karrikins enhance light responses during germination and seedling development in Arabidopsis thaliana. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(15): p. 7095-100 [PMID:20351290] Castells E, et al. det1-1-induced UV-C hyposensitivity through UVR3 and PHR1 photolyase gene over-expression. Plant J., 2010. 63(3): p. 392-404 [PMID:20487384] Aung K,Zhang X,Hu J Peroxisome division and proliferation in plants. Biochem. Soc. Trans., 2010. 38(3): p. 817-22 [PMID:20491669] Conte M,de Simone S,Simmons SJ,Ballar Chromosomal loci important for cotyledon opening under UV-B in Arabidopsis thaliana. BMC Plant Biol., 2010. 10: p. 112 [PMID:20565708] Tsuchiya Y, et al. A small-molecule screen identifies new functions for the plant hormone strigolactone. Nat. Chem. Biol., 2010. 6(10): p. 741-9 [PMID:20818397] Sun XD,Ni M HYPOSENSITIVE TO LIGHT, an alpha/beta fold protein, acts downstream of ELONGATED HYPOCOTYL 5 to regulate seedling de-etiolation. Mol Plant, 2011. 4(1): p. 116-26 [PMID:20864454] Jeong SW, et al. Ethylene suppression of sugar-induced anthocyanin pigmentation in Arabidopsis. Plant Physiol., 2010. 154(3): p. 1514-31 [PMID:20876338] Zhang Y,Zheng S,Liu Z,Wang L,Bi Y Both HY5 and HYH are necessary regulators for low temperature-induced anthocyanin accumulation in Arabidopsis seedlings. J. Plant Physiol., 2011. 168(4): p. 367-74 [PMID:20932601] Gruber H, et al. Negative feedback regulation of UV-B-induced photomorphogenesis and stress acclimation in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(46): p. 20132-7 [PMID:21041653] Pokhilko A, et al. Ubiquitin ligase switch in plant photomorphogenesis: A hypothesis. J. Theor. Biol., 2011. 270(1): p. 31-41 [PMID:21093457] Li J, et al. Arabidopsis transcription factor ELONGATED HYPOCOTYL5 plays a role in the feedback regulation of phytochrome A signaling. Plant Cell, 2010. 22(11): p. 3634-49 [PMID:21097709] Zhang H, et al. Genome-wide mapping of the HY5-mediated gene networks in Arabidopsis that involve both transcriptional and post-transcriptional regulation. Plant J., 2011. 65(3): p. 346-58 [PMID:21265889] Chen H,Xiong L Genetic interaction of two abscisic acid signaling regulators, HY5 and FIERY1, in mediating lateral root formation. Plant Signal Behav, 2011. 6(1): p. 123-5 [PMID:21301222] Tossi V,Amenta M,Lamattina L,Cassia R Nitric oxide enhances plant ultraviolet-B protection up-regulating gene expression of the phenylpropanoid biosynthetic pathway. Plant Cell Environ., 2011. 34(6): p. 909-21 [PMID:21332509] de Brevern AG,Joseph AP Species specific amino acid sequence-protein local structure relationships: An analysis in the light of a structural alphabet. J. Theor. Biol., 2011. 276(1): p. 209-17 [PMID:21333657] Fehér B, et al. Functional interaction of the circadian clock and UV RESISTANCE LOCUS 8-controlled UV-B signaling pathways in Arabidopsis thaliana. Plant J., 2011. 67(1): p. 37-48 [PMID:21395889] Chang CS,Maloof JN,Wu SH COP1-mediated degradation of BBX22/LZF1 optimizes seedling development in Arabidopsis. Plant Physiol., 2011. 156(1): p. 228-39 [PMID:21427283] Li G, et al. Coordinated transcriptional regulation underlying the circadian clock in Arabidopsis. Nat. Cell Biol., 2011. 13(5): p. 616-22 [PMID:21499259] Liu B,Zuo Z,Liu H,Liu X,Lin C Arabidopsis cryptochrome 1 interacts with SPA1 to suppress COP1 activity in response to blue light. Genes Dev., 2011. 25(10): p. 1029-34 [PMID:21511871] Wang JG,Chen CH,Chien CT,Hsieh HL FAR-RED INSENSITIVE219 modulates CONSTITUTIVE PHOTOMORPHOGENIC1 activity via physical interaction to regulate hypocotyl elongation in Arabidopsis. Plant Physiol., 2011. 156(2): p. 631-46 [PMID:21525334] Lee BR,Koprivova A,Kopriva S The key enzyme of sulfate assimilation, adenosine 5'-phosphosulfate reductase, is regulated by HY5 in Arabidopsis. Plant J., 2011. 67(6): p. 1042-54 [PMID:21623972] Holtan HE, et al. BBX32, an Arabidopsis B-Box protein, functions in light signaling by suppressing HY5-regulated gene expression and interacting with STH2/BBX21. Plant Physiol., 2011. 156(4): p. 2109-23 [PMID:21632973] Zhang Y,Liu Z,Liu R,Hao H,Bi Y Gibberellins negatively regulate low temperature-induced anthocyanin accumulation in a HY5/HYH-dependent manner. Plant Signal Behav, 2011. 6(5): p. 632-4 [PMID:21636970] Li Z, et al. The ethylene response factor AtERF11 that is transcriptionally modulated by the bZIP transcription factor HY5 is a crucial repressor for ethylene biosynthesis in Arabidopsis. Plant J., 2011. 68(1): p. 88-99 [PMID:21645149] Shi QM,Yang X,Song L,Xue HW Arabidopsis MSBP1 is activated by HY5 and HYH and is involved in photomorphogenesis and brassinosteroid sensitivity regulation. Mol Plant, 2011. 4(6): p. 1092-104 [PMID:21715650] Yamawaki S,Yamashino T,Nakanishi H,Mizuno T Functional characterization of HY5 homolog genes involved in early light-signaling in Physcomitrella patens. Biosci. Biotechnol. Biochem., 2011. 75(8): p. 1533-9 [PMID:21821942] Sellaro R,Yanovsky MJ,Casal JJ Repression of shade-avoidance reactions by sunfleck induction of HY5 expression in Arabidopsis. Plant J., 2011. 68(5): p. 919-28 [PMID:21848684] Gallego-Bartolom DELLA-induced early transcriptional changes during etiolated development in Arabidopsis thaliana. PLoS ONE, 2011. 6(8): p. e23918 [PMID:21904598] Catal Integration of low temperature and light signaling during cold acclimation response in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2011. 108(39): p. 16475-80 [PMID:21930922] Chao WS,Foley ME,Doğramacı M,Anderson JV,Horvath DP Alternating temperature breaks dormancy in leafy spurge seeds and impacts signaling networks associated with HY5. Funct. Integr. Genomics, 2011. 11(4): p. 637-49 [PMID:21947436] Song YH,Lee I,Lee SY,Imaizumi T,Hong JC CONSTANS and ASYMMETRIC LEAVES 1 complex is involved in the induction of FLOWERING LOCUS T in photoperiodic flowering in Arabidopsis. Plant J., 2012. 69(2): p. 332-42 [PMID:21950734] Li Z,Huang R The reciprocal regulation of abscisic acid and ethylene biosyntheses. Plant Signal Behav, 2011. 6(11): p. 1647-50 [PMID:22057333] Lang-Mladek C, et al. UV-B signaling pathways and fluence rate dependent transcriptional regulation of ARIADNE12. Physiol Plant, 2012. 145(4): p. 527-39 [PMID:22188380] Kindgren P,Nor Interplay between Heat Shock Protein 90 and HY5 controls PhANG expression in response to the GUN5 plastid signal. Mol Plant, 2012. 5(4): p. 901-13 [PMID:22201048] Moriwaki T,Miyazawa Y,Fujii N,Takahashi H Light and abscisic acid signalling are integrated by MIZ1 gene expression and regulate hydrotropic response in roots of Arabidopsis thaliana. Plant Cell Environ., 2012. 35(8): p. 1359-68 [PMID:22321255] Jiang L, et al. Arabidopsis STO/BBX24 negatively regulates UV-B signaling by interacting with COP1 and repressing HY5 transcriptional activity. Cell Res., 2012. 22(6): p. 1046-57 [PMID:22410790] Prasad BR,Kumar SV,Nandi A,Chattopadhyay S Functional interconnections of HY1 with MYC2 and HY5 in Arabidopsis seedling development. BMC Plant Biol., 2012. 12: p. 37 [PMID:22424472] Toh S,McCourt P,Tsuchiya Y HY5 is involved in strigolactone-dependent seed germination in Arabidopsis. Plant Signal Behav, 2012. 7(5): p. 556-8 [PMID:22516816] Chen F, et al. Phosphorylation of FAR-RED ELONGATED HYPOCOTYL1 is a key mechanism defining signaling dynamics of phytochrome A under red and far-red light in Arabidopsis. Plant Cell, 2012. 24(5): p. 1907-20 [PMID:22582101] Nameth B, et al. The shoot regeneration capacity of excised Arabidopsis cotyledons is established during the initial hours after injury and is modulated by a complex genetic network of light signalling. Plant Cell Environ., 2013. 36(1): p. 68-86 [PMID:22681544] Singh A,Ram H,Abbas N,Chattopadhyay S Molecular interactions of GBF1 with HY5 and HYH proteins during light-mediated seedling development in Arabidopsis thaliana. J. Biol. Chem., 2012. 287(31): p. 25995-6009 [PMID:22692212] Das PK, et al. Cytokinins enhance sugar-induced anthocyanin biosynthesis in Arabidopsis. Mol. Cells, 2012. 34(1): p. 93-101 [PMID:22699753] Klose C, et al. The mediator complex subunit PFT1 interferes with COP1 and HY5 in the regulation of Arabidopsis light signaling. Plant Physiol., 2012. 160(1): p. 289-307 [PMID:22760208] Kobayashi K,Obayashi T,Masuda T Role of the G-box element in regulation of chlorophyll biosynthesis in Arabidopsis roots. Plant Signal Behav, 2012. 7(8): p. 922-6 [PMID:22827944] Cloix C, et al. C-terminal region of the UV-B photoreceptor UVR8 initiates signaling through interaction with the COP1 protein. Proc. Natl. Acad. Sci. U.S.A., 2012. 109(40): p. 16366-70 [PMID:22988111] Xie L,Hauser MT Induction of ARI12 upon broad band UV-B radiation is suppressed by UVR8 and cryptochromes. Plant Signal Behav, 2012. 7(11): p. 1411-4 [PMID:22990446] Rolauffs S,Fackendahl P,Sahm J,Fiene G,Hoecker U Arabidopsis COP1 and SPA genes are essential for plant elongation but not for acceleration of flowering time in response to a low red light to far-red light ratio. Plant Physiol., 2012. 160(4): p. 2015-27 [PMID:23093358] Ram H,Chattopadhyay S Molecular interaction of bZIP domains of GBF1, HY5 and HYH in Arabidopsis seedling development. Plant Signal Behav, 2013. 8(1): p. e22703 [PMID:23123453] Waters MT,Smith SM KAI2- and MAX2-mediated responses to karrikins and strigolactones are largely independent of HY5 in Arabidopsis seedlings. Mol Plant, 2013. 6(1): p. 63-75 [PMID:23142794] Huang X, et al. Arabidopsis FHY3 and HY5 positively mediate induction of COP1 transcription in response to photomorphogenic UV-B light. Plant Cell, 2012. 24(11): p. 4590-606 [PMID:23150635] Huseby S, et al. Diurnal and light regulation of sulphur assimilation and glucosinolate biosynthesis in Arabidopsis. J. Exp. Bot., 2013. 64(4): p. 1039-48 [PMID:23314821] Jing Y, et al. Arabidopsis chromatin remodeling factor PICKLE interacts with transcription factor HY5 to regulate hypocotyl cell elongation. Plant Cell, 2013. 25(1): p. 242-56 [PMID:23314848] Zheng X, et al. Arabidopsis phytochrome B promotes SPA1 nuclear accumulation to repress photomorphogenesis under far-red light. Plant Cell, 2013. 25(1): p. 115-33 [PMID:23371951] Maier A, et al. Light and the E3 ubiquitin ligase COP1/SPA control the protein stability of the MYB transcription factors PAP1 and PAP2 involved in anthocyanin accumulation in Arabidopsis. Plant J., 2013. 74(4): p. 638-51 [PMID:23425305] Sarmiento F The BBX subfamily IV: additional cogs and sprockets to fine-tune light-dependent development. Plant Signal Behav, 2013. 8(4): p. e23831 [PMID:23425851] Jang IC,Henriques R,Chua NH Three transcription factors, HFR1, LAF1 and HY5, regulate largely independent signaling pathways downstream of phytochrome A. Plant Cell Physiol., 2013. 54(6): p. 907-16 [PMID:23503597] Shin DH, et al. HY5 regulates anthocyanin biosynthesis by inducing the transcriptional activation of the MYB75/PAP1 transcription factor in Arabidopsis. FEBS Lett., 2013. 587(10): p. 1543-7 [PMID:23583450] Gangappa SN, et al. The Arabidopsis B-BOX protein BBX25 interacts with HY5, negatively regulating BBX22 expression to suppress seedling photomorphogenesis. Plant Cell, 2013. 25(4): p. 1243-57 [PMID:23624715] Chen D, et al. Antagonistic basic helix-loop-helix/bZIP transcription factors form transcriptional modules that integrate light and reactive oxygen species signaling in Arabidopsis. Plant Cell, 2013. 25(5): p. 1657-73 [PMID:23645630] Jing Y,Lin R PICKLE is a repressor in seedling de-etiolation pathway. Plant Signal Behav, 2014. [PMID:23733056] Gangappa SN,Holm M,Botto JF Molecular interactions of BBX24 and BBX25 with HYH, HY5 HOMOLOG, to modulate Arabidopsis seedling development. Plant Signal Behav, 2014. [PMID:23733077] Tilbrook K, et al. The UVR8 UV-B Photoreceptor: Perception, Signaling and Response. Arabidopsis Book, 2013. 11: p. e0164 [PMID:23864838] Ciolfi A, et al. Dynamics of the shade-avoidance response in Arabidopsis. Plant Physiol., 2013. 163(1): p. 331-53 [PMID:23893169] Karayekov E,Sellaro R,Legris M,Yanovsky MJ,Casal JJ Heat shock-induced fluctuations in clock and light signaling enhance phytochrome B-mediated Arabidopsis deetiolation. Plant Cell, 2013. 25(8): p. 2892-906 [PMID:23933882] Ram H,Priya P,Jain M,Chattopadhyay S Genome-wide DNA binding of GBF1 is modulated by its heterodimerizing protein partners, HY5 and HYH. Mol Plant, 2014. 7(2): p. 448-51 [PMID:24157608] Huang X,Deng XW Organization of protein complexes under photomorphogenic UV-B in Arabidopsis. Plant Signal Behav, 2013. 8(11): p. e27206 [PMID:24304604] Yu Y, et al. Ethylene promotes hypocotyl growth and HY5 degradation by enhancing the movement of COP1 to the nucleus in the light. PLoS Genet., 2013. 9(12): p. e1004025 [PMID:24348273] Pac Rapid decline in nuclear costitutive photomorphogenesis1 abundance anticipates the stabilization of its target elongated hypocotyl5 in the light. Plant Physiol., 2014. 164(3): p. 1134-8 [PMID:24434030] Koprivova A,Calderwood A,Lee BR,Kopriva S Do PFT1 and HY5 interact in regulation of sulfate assimilation by light in Arabidopsis? FEBS Lett., 2014. 588(7): p. 1116-21 [PMID:24583010] Tossi V,Lamattina L,Jenkins GI,Cassia RO Ultraviolet-B-induced stomatal closure in Arabidopsis is regulated by the UV RESISTANCE LOCUS8 photoreceptor in a nitric oxide-dependent mechanism. Plant Physiol., 2014. 164(4): p. 2220-30 [PMID:24586043] Abbas N,Maurya JP,Senapati D,Gangappa SN,Chattopadhyay S Arabidopsis CAM7 and HY5 physically interact and directly bind to the HY5 promoter to regulate its expression and thereby promote photomorphogenesis. Plant Cell, 2014. 26(3): p. 1036-52 [PMID:24610722] Xu D, et al. The RING-Finger E3 Ubiquitin Ligase COP1 SUPPRESSOR1 Negatively Regulates COP1 Abundance in Maintaining COP1 Homeostasis in Dark-Grown Arabidopsis Seedlings. Plant Cell, 2014. 26(5): p. 1981-1991 [PMID:24838976] Xu X, et al. PHYTOCHROME INTERACTING FACTOR1 Enhances the E3 Ligase Activity of CONSTITUTIVE PHOTOMORPHOGENIC1 to Synergistically Repress Photomorphogenesis in Arabidopsis. Plant Cell, 2014. 26(5): p. 1992-2006 [PMID:24858936] Toledo-Ortiz G, et al. The HY5-PIF regulatory module coordinates light and temperature control of photosynthetic gene transcription. PLoS Genet., 2014. 10(6): p. e1004416 [PMID:24922306] Ouyang X, et al. Coordinated photomorphogenic UV-B signaling network captured by mathematical modeling. Proc. Natl. Acad. Sci. U.S.A., 2014. 111(31): p. 11539-44 [PMID:25049395] Tsai HL, et al. HUA ENHANCER1 is involved in posttranscriptional regulation of positive and negative regulators in Arabidopsis photomorphogenesis. Plant Cell, 2014. 26(7): p. 2858-72 [PMID:25052717] Vandenbussche F,Van Der Straeten D Differential accumulation of ELONGATED HYPOCOTYL5 correlates with hypocotyl bending to ultraviolet-B light. Plant Physiol., 2014. 166(1): p. 40-3 [PMID:25096978] Desai M,Kaur N,Hu J Ectopic expression of the RING domain of the Arabidopsis peroxin2 protein partially suppresses the phenotype of the photomorphogenic mutant de-etiolated1. PLoS ONE, 2014. 9(9): p. e108473 [PMID:25248106] Binkert M, et al. UV-B-responsive association of the Arabidopsis bZIP transcription factor ELONGATED HYPOCOTYL5 with target genes, including its own promoter. Plant Cell, 2014. 26(10): p. 4200-13 [PMID:25351492] Yanagisawa S Transcription factors involved in controlling the expression of nitrate reductase genes in higher plants. Plant Sci., 2014. 229: p. 167-171 [PMID:25443843] Zhang H, et al. MicroRNA408 is critical for the HY5-SPL7 gene network that mediates the coordinated response to light and copper. Plant Cell, 2014. 26(12): p. 4933-53 [PMID:25516599] Delker C, et al. The DET1-COP1-HY5 pathway constitutes a multipurpose signaling module regulating plant photomorphogenesis and thermomorphogenesis. Cell Rep, 2014. 9(6): p. 1983-9 [PMID:25533339] Kurihara Y, et al. Next-generation sequencing of genomic DNA fragments bound to a transcription factor in vitro reveals its regulatory potential. Genes (Basel), 2014. 5(4): p. 1115-31 [PMID:25534860] Afitlhile M,Fry M,Workman S The TOC159 mutant of Arabidopsis thaliana accumulates altered levels of saturated and polyunsaturated fatty acids. Plant Physiol. Biochem., 2015. 87: p. 61-72 [PMID:25557464] Karumuri S,Bandopadhyay R In silico analysis of the structure and interaction of COP1 protein of Arabidopsis thaliana. Indian J. Biochem. Biophys., 2014. 51(5): p. 343-9 [PMID:25630103] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Abbas N,Chattopadhyay S CAM7 and HY5 genetically interact to regulate root growth and abscisic acid responses. Plant Signal Behav, 2014. 9(9): p. e29763 [PMID:25763709] Dong J,Terzaghi W,Deng XW,Chen H Multiple photomorphogenic repressors work in concert to regulate Arabidopsis seedling development. Plant Signal Behav, 2015. 10(3): p. e1011934 [PMID:25853593] Chai T,Zhou J,Liu J,Xing D LSD1 and HY5 antagonistically regulate red light induced-programmed cell death in Arabidopsis. Front Plant Sci, 2015. 6: p. 292 [PMID:25999965] Su L, et al. Synergistic and Antagonistic Action of Phytochrome (Phy) A and PhyB during Seedling De-Etiolation in Arabidopsis thaliana. Int J Mol Sci, 2015. 16(6): p. 12199-212 [PMID:26030677] Bou-Torrent J, et al. Regulation of Carotenoid Biosynthesis by Shade Relies on Specific Subsets of Antagonistic Transcription Factors and Cofactors. Plant Physiol., 2015. 169(3): p. 1584-94 [PMID:26082398] Hayami N, et al. The Responses of Arabidopsis Early Light-Induced Protein2 to Ultraviolet B, High Light, and Cold Stress Are Regulated by a Transcriptional Regulatory Unit Composed of Two Elements. Plant Physiol., 2015. 169(1): p. 840-55 [PMID:26175515] Huang L,Zhang H,Zhang H,Deng XW,Wei N HY5 regulates nitrite reductase 1 (NIR1) and ammonium transporter1;2 (AMT1;2) in Arabidopsis seedlings. Plant Sci., 2015. 238: p. 330-9 [PMID:26259199] Li QF,He JX BZR1 Interacts with HY5 to Mediate Brassinosteroid- and Light-Regulated Cotyledon Opening in Arabidopsis in Darkness. Mol Plant, 2016. 9(1): p. 113-25 [PMID:26363272] Fernando VC,Schroeder DF Genetic interactions between DET1 and intermediate genes in Arabidopsis ABA signalling. Plant Sci., 2015. 239: p. 166-79 [PMID:26398801] Srivastava AK, et al. Short Hypocotyl in White Light1 Interacts with Elongated Hypocotyl5 (HY5) and Constitutive Photomorphogenic1 (COP1) and Promotes COP1-Mediated Degradation of HY5 during Arabidopsis Seedling Development. Plant Physiol., 2015. 169(4): p. 2922-34 [PMID:26474641] Xie W, et al. Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach. Front Plant Sci, 2015. 6: p. 829 [PMID:26528302] Xu D, et al. Arabidopsis COP1 SUPPRESSOR 2 Represses COP1 E3 Ubiquitin Ligase Activity through Their Coiled-Coil Domains Association. PLoS Genet., 2015. 11(12): p. e1005747 [PMID:26714275] Yu Y, et al. Salt Stress and Ethylene Antagonistically Regulate Nucleocytoplasmic Partitioning of COP1 to Control Seed Germination. Plant Physiol., 2016. 170(4): p. 2340-50 [PMID:26850275] Binkert M, et al. Revisiting chromatin binding of the Arabidopsis UV-B photoreceptor UVR8. BMC Plant Biol., 2016. 16: p. 42 [PMID:26864020] Chen X, et al. Shoot-to-Root Mobile Transcription Factor HY5 Coordinates Plant Carbon and Nitrogen Acquisition. Curr. Biol., 2016. 26(5): p. 640-6 [PMID:26877080] Yang M, et al. Arabidopsis atypical kinase ABC1K1 is involved in red light-mediated development. Plant Cell Rep., 2016. 35(6): p. 1213-20 [PMID:27038938] Pacín M,Semmoloni M,Legris M,Finlayson SA,Casal JJ Convergence of CONSTITUTIVE PHOTOMORPHOGENESIS 1 and PHYTOCHROME INTERACTING FACTOR signalling during shade avoidance. New Phytol., 2016. 211(3): p. 967-79 [PMID:27105120] Lin XL, et al. An Arabidopsis SUMO E3 Ligase, SIZ1, Negatively Regulates Photomorphogenesis by Promoting COP1 Activity. PLoS Genet., 2016. 12(4): p. e1006016 [PMID:27128446] Norén L, et al. Circadian and Plastid Signaling Pathways Are Integrated to Ensure Correct Expression of the CBF and COR Genes during Photoperiodic Growth. Plant Physiol., 2016. 171(2): p. 1392-406 [PMID:27208227] Xu X, et al. Convergence of light and chloroplast signals for de-etiolation through ABI4-HY5 and COP1. Nat Plants, 2016. 2(6): p. 16066 [PMID:27255835] Xu D, et al. BBX21, an Arabidopsis B-box protein, directly activates HY5 and is targeted by COP1 for 26S proteasome-mediated degradation. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(27): p. 7655-60 [PMID:27325768] Carrió-Seguí À,Romero P,Sanz A,Peñarrubia L Interaction Between ABA Signaling and Copper Homeostasis in Arabidopsis thaliana. Plant Cell Physiol., 2016. 57(7): p. 1568-1582 [PMID:27328696] Wang Y,Wang Y,Song Z,Zhang H Repression of MYBL2 by Both microRNA858a and HY5 Leads to the Activation of Anthocyanin Biosynthetic Pathway in Arabidopsis. Mol Plant, 2016. 9(10): p. 1395-1405 [PMID:27450422] Wei CQ, et al. The Arabidopsis B-box protein BZS1/BBX20 interacts with HY5 and mediates strigolactone regulation of photomorphogenesis. J Genet Genomics, 2016. 43(9): p. 555-563 [PMID:27523280] Velanis CN,Herzyk P,Jenkins GI Regulation of transcription by the Arabidopsis UVR8 photoreceptor involves a specific histone modification. Plant Mol. Biol., 2016. 92(4-5): p. 425-443 [PMID:27534420] Loyola R, et al. The photomorphogenic factors UV-B RECEPTOR 1, ELONGATED HYPOCOTYL 5, and HY5 HOMOLOGUE are part of the UV-B signalling pathway in grapevine and mediate flavonol accumulation in response to the environment. J. Exp. Bot., 2016. 67(18): p. 5429-5445 [PMID:27543604] Jaegle B, et al. A fast and simple LC-MS-based characterization of the flavonoid biosynthesis pathway for few seed(ling)s. BMC Plant Biol., 2016. 16(1): p. 190 [PMID:27586417] Myers ZA, et al. NUCLEAR FACTOR Y, Subunit C (NF-YC) Transcription Factors Are Positive Regulators of Photomorphogenesis in Arabidopsis thaliana. PLoS Genet., 2016. 12(9): p. e1006333 [PMID:27685091] Lee HJ, et al. Stem-piped light activates phytochrome B to trigger light responses in Arabidopsis thaliana roots. Sci Signal, 2016. 9(452): p. ra106 [PMID:27803284] Feng XJ, et al. Light affects salt stress-induced transcriptional memory of P5CS1 in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(51): p. E8335-E8343 [PMID:27930298] Gangappa SN,Kumar SV DET1 and HY5 Control PIF4-Mediated Thermosensory Elongation Growth through Distinct Mechanisms. Cell Rep, 2017. 18(2): p. 344-351 [PMID:28076780] Nawkar GM, et al. HY5, a positive regulator of light signaling, negatively controls the unfolded protein response in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(8): p. 2084-2089 [PMID:28167764] Yu Y,Huang R Integration of Ethylene and Light Signaling Affects Hypocotyl Growth in Arabidopsis. Front Plant Sci, 2017. 8: p. 57 [PMID:28174592] Kasulin L, et al. A single haplotype hyposensitive to light and requiring strong vernalization dominates Arabidopsis thaliana populations in Patagonia, Argentina. Mol. Ecol., 2017. 26(13): p. 3389-3404 [PMID:28316114] Li C, et al. Characterization and functional analysis of four HYH splicing variants in Arabidopsis hypocotyl elongation. Gene, 2017. 619: p. 44-49 [PMID:28389360] Perea-Resa C,Rodríguez-Milla MA,Iniesto E,Rubio V,Salinas J Prefoldins Negatively Regulate Cold Acclimation in Arabidopsis thaliana by Promoting Nuclear Proteasome-Mediated HY5 Degradation. Mol Plant, 2017. 10(6): p. 791-804 [PMID:28412546] Park YJ,Lee HJ,Ha JH,Kim JY,Park CM COP1 conveys warm temperature information to hypocotyl thermomorphogenesis. New Phytol., 2017. 215(1): p. 269-280 [PMID:28418582] Zhang Y, et al. Dissection of HY5/HYH expression in Arabidopsis reveals a root-autonomous HY5-mediated photomorphogenic pathway. PLoS ONE, 2017. 12(7): p. e0180449 [PMID:28683099] Zhang X, et al. A PIF1/PIF3-HY5-BBX23 Transcription Factor Cascade Affects Photomorphogenesis. Plant Physiol., 2017. 174(4): p. 2487-2500 [PMID:28687557] Kim SH,Kim H,Chung S,Lee JH DHU1 negatively regulates UV-B signaling via its direct interaction with COP1 and RUP1. Biochem. Biophys. Res. Commun., 2017. 491(2): p. 285-290 [PMID:28735869] Burman N,Bhatnagar A,Khurana JP OsbZIP48, a HY5 Transcription Factor Ortholog, Exerts Pleiotropic Effects in Light-Regulated Development. Plant Physiol., 2018. 176(2): p. 1262-1285 [PMID:28775143] Wang X, et al. A CRY-BIC negative-feedback circuitry regulating blue light sensitivity of Arabidopsis. Plant J., 2017. 92(3): p. 426-436 [PMID:28833729] Liu Y, et al. Light and Ethylene Coordinately Regulate the Phosphate Starvation Response through Transcriptional Regulation of PHOSPHATE STARVATION RESPONSE1. Plant Cell, 2017. 29(9): p. 2269-2284 [PMID:28842534] Liu X,Li Y,Zhong S Interplay between Light and Plant Hormones in the Control of Arabidopsis Seedling Chlorophyll Biosynthesis. Front Plant Sci, 2017. 8: p. 1433 [PMID:28861105] Kim S, et al. High Ambient Temperature Represses Anthocyanin Biosynthesis through Degradation of HY5. Front Plant Sci, 2017. 8: p. 1787 [PMID:29104579] Gao L,Li Y,Shen Z,Han R Responses of He-Ne laser on agronomic traits and the crosstalk between UVR8 signaling and phytochrome B signaling pathway in Arabidopsis thaliana subjected to supplementary ultraviolet-B (UV-B) stress. Protoplasma, 2018. 255(3): p. 761-771 [PMID:29138939] Xu D,Jiang Y,Li J,Holm M,Deng XW The B-Box Domain Protein BBX21 Promotes Photomorphogenesis. Plant Physiol., 2018. 176(3): p. 2365-2375 [PMID:29259103] Sakuraba Y,Yanagisawa S Light signalling-induced regulation of nutrient acquisition and utilisation in plants. Semin. Cell Dev. Biol., 2018. 83: p. 123-132 [PMID:29288799] van Gelderen K, et al. Far-Red Light Detection in the Shoot Regulates Lateral Root Development through the HY5 Transcription Factor. Plant Cell, 2018. 30(1): p. 101-116 [PMID:29321188] Yang Y, et al. UVR8 interacts with WRKY36 to regulate HY5 transcription and hypocotyl elongation in Arabidopsis. Nat Plants, 2018. 4(2): p. 98-107 [PMID:29379156] Job N,Yadukrishnan P,Bursch K,Datta S,Johansson H Two B-Box Proteins Regulate Photomorphogenesis by Oppositely Modulating HY5 through their Diverse C-Terminal Domains. Plant Physiol., 2018. 176(4): p. 2963-2976 [PMID:29439209] Moriconi V, et al. Perception of Sunflecks by the UV-B Photoreceptor UV RESISTANCE LOCUS8. Plant Physiol., 2018. 177(1): p. 75-81 [PMID:29530938] Sakuraba Y, et al. A phytochrome-B-mediated regulatory mechanism of phosphorus acquisition. Nat Plants, 2018. 4(12): p. 1089-1101 [PMID:30518831] Yang B, et al. RSM1, an Arabidopsis MYB protein, interacts with HY5/HYH to modulate seed germination and seedling development in response to abscisic acid and salinity. PLoS Genet., 2018. 14(12): p. e1007839 [PMID:30566447] Ang LH,Deng XW Regulatory hierarchy of photomorphogenic loci: allele-specific and light-dependent interaction between the HY5 and COP1 loci. Plant Cell, 1994. 6(5): p. 613-28 [PMID:8038602] Wei N, et al. Arabidopsis COP8, COP10, and COP11 genes are involved in repression of photomorphogenic development in darkness. Plant Cell, 1994. 6(5): p. 629-43 [PMID:8038603] Barnes SA,Nishizawa NK,Quaggio RB,Whitelam GC,Chua NH Far-red light blocks greening of Arabidopsis seedlings via a phytochrome A-mediated change in plastid development. Plant Cell, 1996. 8(4): p. 601-15 [PMID:8624438] Kwok SF,Piekos B,Misera S,Deng XW A complement of ten essential and pleiotropic arabidopsis COP/DET/FUS genes is necessary for repression of photomorphogenesis in darkness. Plant Physiol., 1996. 110(3): p. 731-42 [PMID:8819865] Pepper AE,Chory J Extragenic suppressors of the Arabidopsis det1 mutant identify elements of flowering-time and light-response regulatory pathways. Genetics, 1997. 145(4): p. 1125-37 [PMID:9093863] Oyama T,Shimura Y,Okada K The Arabidopsis HY5 gene encodes a bZIP protein that regulates stimulus-induced development of root and hypocotyl. Genes Dev., 1997. 11(22): p. 2983-95 [PMID:9367981] Chattopadhyay S,Ang LH,Puente P,Deng XW,Wei N Arabidopsis bZIP protein HY5 directly interacts with light-responsive promoters in mediating light control of gene expression. Plant Cell, 1998. 10(5): p. 673-83 [PMID:9596629] Ang LH, et al. Molecular interaction between COP1 and HY5 defines a regulatory switch for light control of Arabidopsis development. Mol. Cell, 1998. 1(2): p. 213-22 [PMID:9659918] Cheong YH, et al. STF1 is a novel TGACG-binding factor with a zinc-finger motif and a bZIP domain which heterodimerizes with GBF proteins. Plant J., 1998. 15(2): p. 199-209 [PMID:9721678] Torii KU,McNellis TW,Deng XW Functional dissection of Arabidopsis COP1 reveals specific roles of its three structural modules in light control of seedling development. EMBO J., 1998. 17(19): p. 5577-87 [PMID:9755158]