PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G127490_P01
Common NameLOC100193483, ZEAMMB73_817277
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB
Protein Properties Length: 430aa    MW: 47573 Da    PI: 6.4353
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G127490_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.4e-181461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEde+l + ++++G g+W++I++  g+ R++k+c++rw +yl
  GRMZM2G127490_P01 14 KGLWSPEEDEKLMNHITKHGHGCWSSIPKLAGLQRCGKSCRLRWINYL 61
                       678*******************************************97 PP

2Myb_DNA-binding45.32.1e-1467110146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg+++++E++l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  GRMZM2G127490_P01  67 RGAFSQDEEDLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                        89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.274965IPR017930Myb domain
SuperFamilySSF466891.12E-2912108IPR009057Homeodomain-like
SMARTSM007171.5E-121363IPR001005SANT/Myb domain
PfamPF002491.6E-151461IPR001005SANT/Myb domain
CDDcd001679.63E-121761No hitNo description
Gene3DG3DSA:1.10.10.605.3E-2565116IPR009057Homeodomain-like
SMARTSM007172.4E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129420.31766116IPR017930Myb domain
PfamPF002493.1E-1367110IPR001005SANT/Myb domain
CDDcd001673.05E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSSI PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQDEEDLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRQKG  120
IDPNTHKPLT EADRSGAAPT ISTERTSGSS EINPSSAGAL GNLSHLLSET AQSSMLMPVY  180
DKNRAETPNL ARPKVPPKEL FLEQLTAGHE SPSTCRSSGQ TLYFPFQQPL GYNSESGSGD  240
GANMNSLWFN QSDFNCSTIS TVMPPASPSA LSTSMGLNLP PDNSRHGGTG IGSTAVDSFY  300
WDGTNPSSSS STGSRGSNSM GFEPQSTSSI LENSVFQWTD IGQEKDTRAH LVEELKWPDL  360
LHGTFAETTT AMQNQSQTLY DDVIKAESQF SMEGICASWF QNQQPQQQLQ ATPDMYDKDL  420
QRMQLSFENI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.967060.0embryo| meristem| root| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G127490
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G127490_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0357510.0BT035751.1 Zea mays full-length cDNA clone ZM_BFb0081N12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001132070.10.0MYB transcription factor
TrEMBLB4FF630.0B4FF63_MAIZE; MYB transcription factor
STRINGGRMZM2G127490_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.17e-90myb domain protein 61