PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G077789_P02 | ||||||||
Common Name | LOC100384757 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 115aa MW: 13070 Da PI: 9.5939 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60.4 | 3.7e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+lv +v+ +G g+W++ ++ g+ R++k+c++rw +yl GRMZM2G077789_P02 14 KGAWTKEEDERLVAYVRAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61 79******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.2E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 23.972 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 4.2E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.5E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.16E-23 | 15 | 89 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.63E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS50090 | 5.076 | 62 | 115 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-9 | 65 | 88 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.3 | 66 | 109 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007633 | developmental stage | endosperm development stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
MGRSPCCEKA HTNKGAWTKE EDERLVAYVR AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY 60 LRPDLKRGNF TDDEDELIIR LHSLLGNKSV SVCRAAGVLL SSYYSISSRR RCSYS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-17 | 13 | 94 | 26 | 106 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G077789 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269|PubMed:1840903}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, seed pods and flowers. {ECO:0000269|PubMed:1840903}. | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G077789_P02 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT084145 | 0.0 | BT084145.1 Zea mays full-length cDNA clone ZM_BFb0081D04 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001170687.1 | 7e-80 | uncharacterized protein LOC100384757 isoform 2 | ||||
Swissprot | P81393 | 5e-58 | MYB08_ANTMA; Myb-related protein 308 | ||||
Swissprot | Q9SZP1 | 7e-58 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | C4IZZ8 | 2e-78 | C4IZZ8_MAIZE; Uncharacterized protein | ||||
STRING | OGLUM05G18510.1 | 6e-60 | (Oryza glumipatula) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 2e-59 | myb domain protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G077789_P02 |
Entrez Gene | 100384757 |