PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G069028_P01 | ||||||||
Common Name | NS1, WOX3A | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 262aa MW: 27836.1 Da PI: 8.1611 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 65.3 | 8.4e-21 | 6 | 66 | 2 | 57 |
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 ++R+++t+eql +Lee++++ r+p+a+e+++++++l +++ ++V++WFqN++a+e++ GRMZM2G069028_P01 6 STRWCPTPEQLMILEEMYRSgVRTPNAAEIQQITAHLayygRIEGKNVFYWFQNHKARERQ 66 58*****************99**************************************97 PP | |||||||
2 | Wus_type_Homeobox | 121 | 5e-39 | 5 | 67 | 2 | 64 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 ++tRW+PtpeQ++iLee+y+sG+rtPn++eiq+ita+L+ yG+ie+kNVfyWFQN+kaRerq+ GRMZM2G069028_P01 5 PSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKARERQR 67 689***********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 10.463 | 2 | 67 | IPR001356 | Homeobox domain |
SMART | SM00389 | 6.8E-6 | 4 | 71 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.37E-11 | 4 | 70 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 2.54E-4 | 5 | 60 | No hit | No description |
Pfam | PF00046 | 1.8E-18 | 7 | 66 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-7 | 8 | 66 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 262 aa Download sequence Send to blast |
MPQTPSTRWC PTPEQLMILE EMYRSGVRTP NAAEIQQITA HLAYYGRIEG KNVFYWFQNH 60 KARERQRLRR RLCARHQQQY AQQQATAAAP ASSPNSSATV PSLAAGGSSA GVHPAVMQLH 120 HHQHPYATNF MPHQLGYMGQ QVATVPPVLN PAAAGMVDLA AARAGGGNKA TAAGSGAYGG 180 GAGLYNSCSS NQLEEWEATD AMEHCDASCG AASGSSDEGG ALQLPPCCRR PLKTLDLFPT 240 KSTGLKDECS SSKSSSCSTS TN |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G069028 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Predominantly expressed in tissues enriched for shoot meristems and young lateral organ primordia. First expressed in lateral domains of shoot meristems. It is then expressed in the margins of young lateral organ primordia. Not expressed in roots, seedling leaves or fully expanded coleoptiles. Also expressed in vegetative shoot apices (five leaf primordia and the SAM) and in the male inflorescence. Expressed at low level in the female inflorescence. {ECO:0000269|PubMed:15169755}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in leaf formation. {ECO:0000269|PubMed:15169755}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G069028_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ536578 | 0.0 | AJ536578.1 Zea mays mRNA for homeodomain transcription factor (prs gene). | |||
GenBank | BT066120 | 0.0 | BT066120.1 Zea mays full-length cDNA clone ZM_BFb0350F05 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001105160.1 | 0.0 | WUSCHEL-related homeobox 3A | ||||
Swissprot | Q70UV1 | 0.0 | WOX3A_MAIZE; WUSCHEL-related homeobox 3A | ||||
TrEMBL | A0A3L6G2S1 | 0.0 | A0A3L6G2S1_MAIZE; WUSCHEL-related homeobox 3A | ||||
TrEMBL | C0PCV1 | 0.0 | C0PCV1_MAIZE; WUSCHEL-related homeobox 3A | ||||
TrEMBL | K4JBS6 | 0.0 | K4JBS6_MAIZE; HB-type transcription factor (Fragment) | ||||
STRING | GRMZM2G069028_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2177 | 38 | 97 | Representative plant | OGRP5580 | 11 | 21 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28610.1 | 1e-34 | WOX family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G069028_P01 |
Entrez Gene | 542051 |
Publications ? help Back to Top | |||
---|---|---|---|
|