PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G28610.1

Common Name

PRS, PRS1, T8O18.10, WOX3

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WOX

Protein Properties

Length: 244aa MW: 28134.3 Da PI: 9.5278

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G28610.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	62.2	7.6e-20	6	66	2	57
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 ++R+++t+eql +Lee++++ r+p+a ++++++++l +++ ++V++WFqN++a++++ AT2G28610.1 6 STRWCPTPEQLMILEEMYRSgIRTPNAVQIQQITAHLafygRIEGKNVFYWFQNHKARDRQ 66 58***************99***********************************996 PP
2	Wus_type_Homeobox	120.2	8.9e-39	5	67	2	64
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 a+tRW+PtpeQ++iLee+y+sG+rtPn+ +iq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqk AT2G28610.1 5 ASTRWCPTPEQLMILEEMYRSGIRTPNAVQIQQITAHLAFYGRIEGKNVFYWFQNHKARDRQK 67 589***********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00389	0.0013	4	71	IPR001356	Homeobox domain
SuperFamily	SSF46689	6.42E-11	7	66	IPR009057	Homeodomain-like
CDD	cd00086	1.03E-4	7	67	No hit	No description
Pfam	PF00046	1.6E-17	7	66	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	4.5E-7	8	66	IPR009057	Homeodomain-like
PROSITE profile	PS50071	9.766	12	67	IPR001356	Homeobox domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0008283	Biological Process	cell proliferation
GO:0009908	Biological Process	flower development
GO:0009943	Biological Process	adaxial/abaxial axis specification
GO:0009947	Biological Process	centrolateral axis specification
GO:0010865	Biological Process	stipule development
GO:0030154	Biological Process	cell differentiation
GO:0048513	Biological Process	animal organ development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000015	anatomy	cotyledon primordium
PO:0000017	anatomy	vascular leaf primordium
PO:0000021	anatomy	petal primordium
PO:0000037	anatomy	shoot apex
PO:0000054	anatomy	petal vascular system
PO:0000229	anatomy	flower meristem
PO:0004704	anatomy	sepal primordium
PO:0004705	anatomy	stamen primordium
PO:0005021	anatomy	sepal margin
PO:0006504	anatomy	leaf trichome
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0020128	anatomy	leaf margin
PO:0025022	anatomy	collective leaf structure
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 244 aa Download sequence Send to blast
MSPVASTRWC PTPEQLMILE EMYRSGIRTP NAVQIQQITA HLAFYGRIEG KNVFYWFQNH 60 KARDRQKLRK KLAKQLHQQQ HQLQLQLQQI KPKPISSMIS QPVNKNIIDH HNPYHHHHHN 120 HHHNHHRPYD HMSFDCCSHP SPMCLPHQGT GVGEAPSKVM NEYYCTKSGA EEILMQKSIT 180 GPNSSYGRDW MMMMDMGPRP SYPSSSSSPI SCCNMMMSSP KIPLKTLELF PISSINSKQD 240 STKL

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	263434_at	0.0
Expression Atlas	AT2G28610	-
AtGenExpress	AT2G28610	-
ATTED-II	AT2G28610	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: First expressed in the L1 cells of the lateral regions of a flower primordium at early stage 1, in which the lateral sepals are expected to develop at a later stage. It then rapidly decreases at the late stage 1 and disappears at stage 2. At stage 3, it reappears in all four-sepal young primordia. Not detected at the central zone of the inflorescence meristem and the floral meristem. In stages 4 through 6, when four sepals develop to enclose the flower bud, it is localized at the lateral edges of the four sepals and forms an arch of the L1 cells at the margin of sepals. Expressed in the young primordia of petals and stamens. As the petals and stamens develop, it is limited at the margins of petals and stamens in a way similar to that of sepals. In the vegetative phase, it is expressed at the lateral regions of young leaf primordia, as well as in flowers and floral organs. {ECO:0000269\|PubMed:11751640, ECO:0000269\|PubMed:14711878}.
Uniprot	TISSUE SPECIFICITY: Expressed in aerial parts of seedlings, inflorescences and flowers at low level. Expressed in a restricted number of L1 cells at the lateral regions of flower primordia. {ECO:0000269\|PubMed:11751640}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a homeodomain containing protein that regulates lateral axis-dependent development of Arabidopsis flowers and is required for cell proliferation. It is expressed in a restricted number of L1 cells at the lateral regions of flower primordia, floral organ primordia, and young leaf primordia.
UniProt	Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269\|PubMed:11751640, ECO:0000269\|PubMed:15169755}.

Function -- GeneRIF ? help Back to Top
Specific expression of PRS and WOX1 in a domain between the adaxial and abaxial domains is important for lateral-specific blade outgrowth and margin-specific cell fate. [PMID: 22374393] Adaxial-expressed MONOPTEROS (MP) and abaxial-enriched auxin together act as positional cues for patterning the WOX domain. MP directly binds to the WOX1 and PRS promoters and activates their expression. [PMID: 28943086]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G28610.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT4G00180(R)

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G28610

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB058920	0.0	AB058920.1 Arabidopsis thaliana PRS mRNA for PRESSED FLOWER, complete cds.
GenBank	AY251397	0.0	AY251397.1 Arabidopsis thaliana PRS/WOX3 protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_180429.1	0.0	Homeodomain-like superfamily protein
Swissprot	Q9SIB4	0.0	WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBL	A0A384LML6	0.0	A0A384LML6_ARATH; WOX3
TrEMBL	A0MEQ6	0.0	A0MEQ6_ARATH; Uncharacterized protein (Fragment)
TrEMBL	Q1PEZ2	0.0	Q1PEZ2_ARATH; Homeobox-leucine zipper transcription factor
STRING	AT2G28610.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7480	26	42
Representative plant	OGRP5580	11	21

Link Out ? help Back to Top
Phytozome	AT2G28610.1
Entrez Gene	817410
iHOP	AT2G28610
wikigenes	AT2G28610

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Matsumoto N,Okada K A homeobox gene, PRESSED FLOWER, regulates lateral axis-dependent development of Arabidopsis flowers. Genes Dev., 2001. 15(24): p. 3355-64 [PMID:11751640] Haecker A, et al. Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana. Development, 2004. 131(3): p. 657-68 [PMID:14711878] Nardmann J,Ji J,Werr W,Scanlon MJ The maize duplicate genes narrow sheath1 and narrow sheath2 encode a conserved homeobox gene function in a lateral domain of shoot apical meristems. Development, 2004. 131(12): p. 2827-39 [PMID:15169755] Dai M,Hu Y,Zhao Y,Liu H,Zhou DX A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development. Plant Physiol., 2007. 144(1): p. 380-90 [PMID:17351053] Shimizu R, et al. Tissue specificity and evolution of meristematic WOX3 function. Plant Physiol., 2009. 149(2): p. 841-50 [PMID:19073779] Karim MR,Hirota A,Kwiatkowska D,Tasaka M,Aida M A role for Arabidopsis PUCHI in floral meristem identity and bract suppression. Plant Cell, 2009. 21(5): p. 1360-72 [PMID:19482972] Dai M,Hu Y,Zhao Y,Zhou DX Regulatory Networks Involving YABBY Genes in Rice Shoot Development. Plant Signal Behav, 2007. 2(5): p. 399-400 [PMID:19704613] Vandenbussche M, et al. Differential recruitment of WOX transcription factors for lateral development and organ fusion in Petunia and Arabidopsis. Plant Cell, 2009. 21(8): p. 2269-83 [PMID:19717616] Ji J,Shimizu R,Sinha N,Scanlon MJ Analyses of WOX4 transgenics provide further evidence for the evolution of the WOX gene family during the regulation of diverse stem cell functions. Plant Signal Behav, 2010. 5(7): p. 916-20 [PMID:20495368] Hirakawa Y,Kondo Y,Fukuda H TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis. Plant Cell, 2010. 22(8): p. 2618-29 [PMID:20729381] Zhang X,Zong J,Liu J,Yin J,Zhang D Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar. J Integr Plant Biol, 2010. 52(11): p. 1016-26 [PMID:20977659] Nakata M, et al. Roles of the middle domain-specific WUSCHEL-RELATED HOMEOBOX genes in early development of leaves in Arabidopsis. Plant Cell, 2012. 24(2): p. 519-35 [PMID:22374393] Nakata M,Okada K The three-domain model: a new model for the early development of leaves in Arabidopsis thaliana. Plant Signal Behav, 2012. 7(11): p. 1423-7 [PMID:22951404] Cho SH, et al. The rice narrow leaf2 and narrow leaf3 loci encode WUSCHEL-related homeobox 3A (OsWOX3A) and function in leaf, spikelet, tiller and lateral root development. New Phytol., 2013. 198(4): p. 1071-84 [PMID:23551229] Chandler JW,Werr W Arabidopsis floral phytomer development: auxin response relative to biphasic modes of organ initiation. J. Exp. Bot., 2014. 65(12): p. 3097-110 [PMID:24744428] Niu L, et al. LOOSE FLOWER, a WUSCHEL-like Homeobox gene, is required for lateral fusion of floral organs in Medicago truncatula. Plant J., 2015. 81(3): p. 480-92 [PMID:25492397] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Guan C, et al. Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis. Curr. Biol., 2017. 27(19): p. 2940-2950.e4 [PMID:28943086]