PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G057116_P01 | ||||||||
Common Name | ZEAMMB73_750992, Zm.82925 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 205aa MW: 22045.1 Da PI: 7.0399 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 97 | 1.3e-30 | 107 | 165 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K vk+s++pr+YYrC+s+gC vkk+ver+++dp++v++tY g Hnh GRMZM2G057116_P01 107 LDDGFKWRKYGKKAVKNSPNPRNYYRCSSEGCGVKKRVERDRDDPRYVITTYDGVHNHA 165 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 8.3E-33 | 95 | 167 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.41E-28 | 99 | 167 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.996 | 102 | 167 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.2E-35 | 107 | 166 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.7E-24 | 108 | 164 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 205 aa Download sequence Send to blast |
MATSLGLNPE DLFTSYSSSY YSSPPFMSDY AASFTPAAGD STAFSSELDD LHHFDYSPAP 60 IVTAAGAGAG GGDRNEKMMW CEGGGDERRL RSNGRIGFRT RSEVEILDDG FKWRKYGKKA 120 VKNSPNPRNY YRCSSEGCGV KKRVERDRDD PRYVITTYDG VHNHASPGAA AIIVPYGSGG 180 GNSGFYSPPH SGSPSATSYS GSLAF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-27 | 92 | 167 | 2 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 1e-27 | 92 | 167 | 2 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.124783 | 0.0 | root |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G057116 |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G057116_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT064457 | 0.0 | BT064457.1 Zea mays full-length cDNA clone ZM_BFc0171E09 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001316724.1 | 1e-149 | uncharacterized protein LOC100193498 | ||||
TrEMBL | A0A3L6DPP4 | 1e-148 | A0A3L6DPP4_MAIZE; Putative WRKY transcription factor 50 | ||||
TrEMBL | C0P838 | 1e-148 | C0P838_MAIZE; Putative WRKY transcription factor 50 | ||||
STRING | GRMZM2G057116_P01 | 1e-149 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 | Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 2e-41 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G057116_P01 |