PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GRMZM2G026223_P07

Common Name

LOC100279630

Organism

Zea mays

Taxonomic ID

4577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

MIKC_MADS

Protein Properties

Length: 189aa MW: 21879.3 Da PI: 9.8695

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G026223_P07	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	92.6	1.9e-29	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien rqvtfskRrng+lKKA+ELSvLCdaeva+++fs++gklye++s GRMZM2G026223_P07 9 KRIENPASRQVTFSKRRNGLLKKAFELSVLCDAEVALVVFSPRGKLYEFAS 59 79***********************************************86 PP
2	K-box	52.3	2.5e-18	78	144	6	72
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnel 72 ++++++++ e+ + +++ L k++e L+ +R+llGe Le++s++eL++Le +Leksl iR +K + GRMZM2G026223_P07 78 SNKTAHQDIEQVKADAEGLAKKLEALEAYKRKLLGERLEECSFEELHSLEVKLEKSLHCIRGRKVSY 144 444788999*******************************************************765 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	5.8E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.076	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.22E-32	3	81	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-30	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.75E-41	3	75	No hit	No description
Pfam	PF00319	3.0E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-30	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-30	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	8.9E-18	82	143	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	8.719	86	181	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 189 aa Download sequence Send to blast
MVRGKTQMKR IENPASRQVT FSKRRNGLLK KAFELSVLCD AEVALVVFSP RGKLYEFASG 60 SAQKTIERYR TYTKDNVSNK TAHQDIEQVK ADAEGLAKKL EALEAYKRKL LGERLEECSF 120 EELHSLEVKL EKSLHCIRGR KVSYFPHVVL CIQYMYDVLT NELKAAYIHM RIWSYVHGRL 180 SCWRSNSIS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3mu6_A	6e-19	3	72	2	71	Myocyte-specific enhancer factor 2A
3mu6_B	6e-19	3	72	2	71	Myocyte-specific enhancer factor 2A
3mu6_C	6e-19	3	72	2	71	Myocyte-specific enhancer factor 2A
3mu6_D	6e-19	3	72	2	71	Myocyte-specific enhancer factor 2A
6byy_A	9e-19	1	73	1	73	MEF2 CHIMERA
6byy_B	9e-19	1	73	1	73	MEF2 CHIMERA
6byy_C	9e-19	1	73	1	73	MEF2 CHIMERA
6byy_D	9e-19	1	73	1	73	MEF2 CHIMERA
6bz1_A	9e-19	1	78	1	78	MEF2 CHIMERA
6bz1_B	9e-19	1	78	1	78	MEF2 CHIMERA
6bz1_C	9e-19	1	78	1	78	MEF2 CHIMERA
6bz1_D	9e-19	1	78	1	78	MEF2 CHIMERA
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Zm.96018	0.0	endosperm\| meristem\| ovary\| pollen\| shoot

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G026223

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Low expression in the young panicle continues to decline as the organ mature. {ECO:0000269\|PubMed:15144377, ECO:0000269\|PubMed:17166135}.
Uniprot	TISSUE SPECIFICITY: Expressed in mature leaves and at low levels in roots and young panicles. {ECO:0000269\|PubMed:15144377, ECO:0000269\|PubMed:17166135}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269\|PubMed:15144377, ECO:0000269\|PubMed:17166135}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G026223_P07

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT062798	0.0	BT062798.1 Zea mays full-length cDNA clone ZM_BFb0347K21 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008672798.1	3e-98	putative MADS-box transcription factor family protein isoform X1
Swissprot	Q9XJ60	5e-87	MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBL	C0P3C9	1e-138	C0P3C9_MAIZE; Agamous-like6
STRING	GRMZM2G026223_P04	1e-97	(Zea mays)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45660.1	2e-63	AGAMOUS-like 20

Link Out ? help Back to Top
Phytozome	GRMZM2G026223_P07

Publications ? help Back to Top
Thomson MJ,Edwards JD,Septiningsih EM,Harrington SE,McCouch SR Substitution mapping of dth1.1, a flowering-time quantitative trait locus (QTL) associated with transgressive variation in rice, reveals multiple sub-QTL. Genetics, 2006. 172(4): p. 2501-14 [PMID:16452146] Park SJ, et al. Rice Indeterminate 1 (OsId1) is necessary for the expression of Ehd1 (Early heading date 1) regardless of photoperiod. Plant J., 2008. 56(6): p. 1018-29 [PMID:18774969] Lee S,Jeong DH,An G A possible working mechanism for rice SVP-group MADS-box proteins as negative regulators of brassinosteroid responses. Plant Signal Behav, 2008. 3(7): p. 471-4 [PMID:19704489] Maas LF,McClung A,McCouch S Dissection of a QTL reveals an adaptive, interacting gene complex associated with transgressive variation for flowering time in rice. Theor. Appl. Genet., 2010. 120(5): p. 895-908 [PMID:19949767] Sun C, et al. The histone methyltransferase SDG724 mediates H3K36me2/3 deposition at MADS50 and RFT1 and promotes flowering in rice. Plant Cell, 2012. 24(8): p. 3235-47 [PMID:22892321] Choi SC, et al. Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3. Plant Physiol., 2014. 164(3): p. 1326-37 [PMID:24420930] Núñez-López L,Aguirre-Cruz A,Barrera-Figueroa BE,Peña-Castro JM Improvement of enzymatic saccharification yield in Arabidopsis thaliana by ectopic expression of the rice SUB1A-1 transcription factor. PeerJ, 2015. 3: p. e817 [PMID:25780769] Jin J, et al. MORF-RELATED GENE702, a Reader Protein of Trimethylated Histone H3 Lysine 4 and Histone H3 Lysine 36, Is Involved in Brassinosteroid-Regulated Growth and Flowering Time Control in Rice. Plant Physiol., 2015. 168(4): p. 1275-85 [PMID:25855537] Liu X, et al. Brassinosteroid (BR) biosynthetic gene lhdd10 controls late heading and plant height in rice (Oryza sativa L.). Plant Cell Rep., 2016. 35(2): p. 357-68 [PMID:26518431] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Shibaya T, et al. Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice. Plant Cell Physiol., 2016. 57(9): p. 1828-38 [PMID:27318280] Alter P, et al. Flowering Time-Regulated Genes in Maize Include the Transcription Factor ZmMADS1. Plant Physiol., 2016. 172(1): p. 389-404 [PMID:27457125]