PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G026223_P05
Common NameLOC100279630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MIKC_MADS
Protein Properties Length: 200aa    MW: 22477.9 Da    PI: 9.7054
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G026223_P05genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.42.1e-29959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krien   rqvtfskRrng+lKKA+ELSvLCdaeva+++fs++gklye++s
  GRMZM2G026223_P05  9 KRIENPASRQVTFSKRRNGLLKKAFELSVLCDAEVALVVFSPRGKLYEFAS 59
                       79***********************************************86 PP

2K-box49.51.8e-1778142670
              K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                        ++++++++ e+ + +++ L k++e L+  +R+llGe Le++s++eL++Le +Leksl  iR +K 
  GRMZM2G026223_P05  78 SNKTAHQDIEQVKADAEGLAKKLEALEAYKRKLLGERLEECSFEELHSLEVKLEKSLHCIRGRKC 142
                        444788999******************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.8E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.076161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-32381IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-30323IPR002100Transcription factor, MADS-box
CDDcd002652.50E-41375No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.3E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.1E-1682142IPR002487Transcription factor, K-box
PROSITE profilePS512977.88386200IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MVRGKTQMKR IENPASRQVT FSKRRNGLLK KAFELSVLCD AEVALVVFSP RGKLYEFASG  60
SAQKTIERYR TYTKDNVSNK TAHQDIEQVK ADAEGLAKKL EALEAYKRKL LGERLEECSF  120
EELHSLEVKL EKSLHCIRGR KCKKQPPPPP PMLMAPPPPP APAAIDHTGP KDVGMDVETE  180
LYIGLPGRDY RSNNKDMTAQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A1e-19372271Myocyte-specific enhancer factor 2A
3mu6_B1e-19372271Myocyte-specific enhancer factor 2A
3mu6_C1e-19372271Myocyte-specific enhancer factor 2A
3mu6_D1e-19372271Myocyte-specific enhancer factor 2A
5f28_A2e-19172172MEF2C
5f28_B2e-19172172MEF2C
5f28_C2e-19172172MEF2C
5f28_D2e-19172172MEF2C
6byy_A2e-19173173MEF2 CHIMERA
6byy_B2e-19173173MEF2 CHIMERA
6byy_C2e-19173173MEF2 CHIMERA
6byy_D2e-19173173MEF2 CHIMERA
6bz1_A2e-19173173MEF2 CHIMERA
6bz1_B2e-19173173MEF2 CHIMERA
6bz1_C2e-19173173MEF2 CHIMERA
6bz1_D2e-19173173MEF2 CHIMERA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.960180.0endosperm| meristem| ovary| pollen| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G026223
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Low expression in the young panicle continues to decline as the organ mature. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}.
UniprotTISSUE SPECIFICITY: Expressed in mature leaves and at low levels in roots and young panicles. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}.
Function -- GeneRIF ? help Back to Top
  1. Recombinant chromosome isogenic lines between Zea mays ssp. mays and Zea mays ssp. parviglumis differing in the zagl1 alleles show that the maize allele influences flowering time and traits related to ear size.
    [PMID: 28992108]
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G026223_P05
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0546170.0BT054617.1 Zea mays full-length cDNA clone ZM_BFb0029H23 mRNA, complete cds.
GenBankBT0627980.0BT062798.1 Zea mays full-length cDNA clone ZM_BFb0347K21 mRNA, complete cds.
GenBankEU9607740.0EU960774.1 Zea mays clone 228490 MADS-box transcription factor 56 mRNA, complete cds.
GenBankEU9625040.0EU962504.1 Zea mays clone 243238 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008672806.11e-147putative MADS-box transcription factor family protein isoform X2
SwissprotQ9XJ602e-95MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLA0A317Y8W81e-123A0A317Y8W8_MAIZE; MADS-box transcription factor 50
TrEMBLB6T7091e-123B6T709_MAIZE; Agamous-like6
STRINGGRMZM2G026223_P041e-124(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-62AGAMOUS-like 20
Publications ? help Back to Top
  1. Thomson MJ,Edwards JD,Septiningsih EM,Harrington SE,McCouch SR
    Substitution mapping of dth1.1, a flowering-time quantitative trait locus (QTL) associated with transgressive variation in rice, reveals multiple sub-QTL.
    Genetics, 2006. 172(4): p. 2501-14
    [PMID:16452146]
  2. Park SJ, et al.
    Rice Indeterminate 1 (OsId1) is necessary for the expression of Ehd1 (Early heading date 1) regardless of photoperiod.
    Plant J., 2008. 56(6): p. 1018-29
    [PMID:18774969]
  3. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]
  4. Lee S,Jeong DH,An G
    A possible working mechanism for rice SVP-group MADS-box proteins as negative regulators of brassinosteroid responses.
    Plant Signal Behav, 2008. 3(7): p. 471-4
    [PMID:19704489]
  5. Maas LF,McClung A,McCouch S
    Dissection of a QTL reveals an adaptive, interacting gene complex associated with transgressive variation for flowering time in rice.
    Theor. Appl. Genet., 2010. 120(5): p. 895-908
    [PMID:19949767]
  6. Sun C, et al.
    The histone methyltransferase SDG724 mediates H3K36me2/3 deposition at MADS50 and RFT1 and promotes flowering in rice.
    Plant Cell, 2012. 24(8): p. 3235-47
    [PMID:22892321]
  7. Choi SC, et al.
    Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3.
    Plant Physiol., 2014. 164(3): p. 1326-37
    [PMID:24420930]
  8. Núñez-López L,Aguirre-Cruz A,Barrera-Figueroa BE,Peña-Castro JM
    Improvement of enzymatic saccharification yield in Arabidopsis thaliana by ectopic expression of the rice SUB1A-1 transcription factor.
    PeerJ, 2015. 3: p. e817
    [PMID:25780769]
  9. Jin J, et al.
    MORF-RELATED GENE702, a Reader Protein of Trimethylated Histone H3 Lysine 4 and Histone H3 Lysine 36, Is Involved in Brassinosteroid-Regulated Growth and Flowering Time Control in Rice.
    Plant Physiol., 2015. 168(4): p. 1275-85
    [PMID:25855537]
  10. Liu X, et al.
    Brassinosteroid (BR) biosynthetic gene lhdd10 controls late heading and plant height in rice (Oryza sativa L.).
    Plant Cell Rep., 2016. 35(2): p. 357-68
    [PMID:26518431]
  11. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  12. Shibaya T, et al.
    Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice.
    Plant Cell Physiol., 2016. 57(9): p. 1828-38
    [PMID:27318280]
  13. Alter P, et al.
    Flowering Time-Regulated Genes in Maize Include the Transcription Factor ZmMADS1.
    Plant Physiol., 2016. 172(1): p. 389-404
    [PMID:27457125]
  14. Wills DM,Fang Z,York AM,Holland JB,Doebley JF
    Defining the Role of the MADS-Box Gene, Zea Agamous-like1, a Target of Selection During Maize Domestication.
    J. Hered., 2018. 109(3): p. 333-338
    [PMID:28992108]