PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G017520_P01
Common NameMYB128, Zm.4245
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB
Protein Properties Length: 427aa    MW: 47325.8 Da    PI: 7.0494
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G017520_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.3e-181461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEde+l + ++++G g+W+t+++  g+ R++k+c++rw +yl
  GRMZM2G017520_P01 14 KGLWSPEEDEKLMNHITKHGHGCWSTVPKLAGLQRCGKSCRLRWINYL 61
                       678*******************************************97 PP

2Myb_DNA-binding47.83.2e-1567109145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        rg++++eE++l+v++++ lG++ W+ Ia +++ gRt++++k+ w+
  GRMZM2G017520_P01  67 RGAFSEEEEDLIVELHAVLGNR-WSQIATRLP-GRTDNEIKNLWN 109
                        89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.396961IPR017930Myb domain
SuperFamilySSF466892.66E-2912108IPR009057Homeodomain-like
SMARTSM007176.5E-121363IPR001005SANT/Myb domain
PfamPF002495.5E-151461IPR001005SANT/Myb domain
CDDcd001671.00E-101761No hitNo description
PROSITE profilePS5129425.25362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2465116IPR009057Homeodomain-like
SMARTSM007172.5E-1366114IPR001005SANT/Myb domain
PfamPF002496.9E-1467109IPR001005SANT/Myb domain
CDDcd001677.64E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSTV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SEEEEDLIVE LHAVLGNRWS QIATRLPGRT DNEIKNLWNS SIKKKLRQKG  120
IDPNTHKPLL VEVERSKAAP TTSTERTSES SDVDPSSGGA LGNSSHLLLS ETAQSPQLPA  180
LGKHRRETTS LAHLRVPPKE LFLDQLVSGH ENLTGCRTAG PVPNFPFQQL MCYSNEFGNK  240
NGASNNSLWF NHNETSGSTI STVMPPVSPS TLSTSTGLNR SPDNPHSGGT GIQSTQFYWD  300
TANPSSCSSR GSSGSNGLGF ELQSTSSLLE SSVFPWTELT PDKNSQVHLG EELKWPDLLH  360
GTFTDTPATM QNLSQSLYED VIKAESQFNI EGLCAAWSQN LQPQQHLQVS DLYDKDLQRM  420
SLSFENI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.42450.0meristem| root| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G017520
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G017520_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269010.0KJ726901.1 Zea mays clone pUT3446 MYB transcription factor (MYB128) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147101.10.0uncharacterized LOC100280710
TrEMBLA0A060CYU20.0A0A060CYU2_MAIZE; MYB transcription factor (Fragment)
STRINGGRMZM2G017520_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.18e-87myb domain protein 61