PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G013612_P01
Common NameLOC103646635, Zm.132482
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family ARR-B
Protein Properties Length: 392aa    MW: 44074.6 Da    PI: 6.8479
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G013612_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like475.7e-15166216355
            G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         l Wtp L ++F++ave L G+  A Pk+i  lm+v++++++++  HLQk+R 
  GRMZM2G013612_P01 166 HLMWTPFLQRKFLQAVELL-GE-DASPKKIQLLMNVNSVSRKQISAHLQKHRK 216
                        689****************.55.5***************************96 PP

2Response_reg38.46.8e-14171232107
                        EEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHH CS
       Response_reg   2 livdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealk 91 
                        ++vd++   +++   +l + ++ +v + +++ +al+ lk+++   D  l+ ++m +m+G+++l   r+ +++l++i+++a  + +++++ ++
  GRMZM2G013612_P01  17 IVVDENLCHARAASCMLANLQC-KVIVYASPVDALKFLKDHQrdTDFALVEVNMKEMHGFQFLDMSRKLHKSLQVIMMSADTTWPTMKRSVE 107
                        578888888899999999****.9**************988888************************************************ PP

                        TTESEEEESS--HHHH CS
       Response_reg  92 aGakdflsKpfdpeel 107
                        +Ga+  + Kp d + +
  GRMZM2G013612_P01 108 LGARFLIKKPLDANTM 123
                        **********998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521728.54E-2013131IPR011006CheY-like superfamily
SMARTSM004481.3E-414127IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011022.21715131IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23003.3E-1915138No hitNo description
CDDcd001562.79E-1117121No hitNo description
PfamPF000725.0E-1317124IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:1.10.10.607.9E-15162220IPR009057Homeodomain-like
SuperFamilySSF466891.08E-10163220IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-15167217IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MGTQIVREQT SGSLTAIVVD ENLCHARAAS CMLANLQCKV IVYASPVDAL KFLKDHQRDT  60
DFALVEVNMK EMHGFQFLDM SRKLHKSLQV IMMSADTTWP TMKRSVELGA RFLIKKPLDA  120
NTMNNLWQHL DLKFQRTDKI KALFPGIEGK TGNAFEEGTN KQKGTHLMWT PFLQRKFLQA  180
VELLGEDASP KKIQLLMNVN SVSRKQISAH LQKHRKKVEK ELRNSNANNS SHGIGGASNS  240
RPSRIFEISH GRFQYNRPDV QPEHRSDESV SVEQTETIEE TQSNRLYEAM RRALQLGSVF  300
EEPQLPNDPP AGKDAREVEE VEMTMRDGNY RDAGTDAFGD KNEASGTHSS DGNNAKVKSK  360
DDSADKLVSC HDELRPVVTL VTYSDSEDGE TL
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G013612
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G013612_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9437540.0EU943754.1 Zea mays clone 1685039 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669569.10.0two-component response regulator ORR29 isoform X1
TrEMBLA0A1D6EDG30.0A0A1D6EDG3_MAIZE; OSJNBa0020I02.16-like protein
STRINGGRMZM2G013612_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59202345
Representative plantOGRP1117845
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31920.17e-20response regulator 10