PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G005353_P01 | ||||||||
Common Name | yab14, ZEAMMB73_397307, Zm.98944 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 268aa MW: 28271.2 Da PI: 7.2474 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 183.2 | 1.5e-56 | 24 | 224 | 7 | 170 |
YABBY 7 seqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakas....qllaaeshldeslkee........................ 70 eq+Cyv+C++C+tilav vP +slf++vtvrCGhC++ll vnl+ ++ aa +hl ++ GRMZM2G005353_P01 24 QEQICYVHCSYCDTILAVGVPCSSLFQTVTVRCGHCANLLYVNLRALLlppaTAPAAANHLPPFGQ-Allsptsphglldaetmssssfqap 114 79******************************************9988555445555566543332.1356678889655555555555444 PP YABBY 71 .......lleelkveeenlksnvekeesastsvssekl........................senedeevprvpp.virPPekrqrvPsayn 130 + ++ + +e ++pr +++ ekrqrvPsayn GRMZM2G005353_P01 115 slpsaepP----------------------SAACVSGItsinntacggnnaasamapppakpALHEPPQLPRSAAsANKTSEKRQRVPSAYN 184 43332221......................22222222233444455555555556766555677777888876669*************** PP YABBY 131 rfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 rfik+eiqrikasnPdi+hreafsaaaknWahfP+ihfgl GRMZM2G005353_P01 185 RFIKDEIQRIKASNPDITHREAFSAAAKNWAHFPHIHFGL 224 **************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 2.7E-64 | 23 | 224 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.03E-7 | 163 | 218 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 2.0E-4 | 173 | 216 | IPR009071 | High mobility group box domain |
CDD | cd00084 | 8.31E-5 | 178 | 214 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 268 aa Download sequence Send to blast |
MTSPVPETFS LQDQQPPPPP PAEQEQICYV HCSYCDTILA VGVPCSSLFQ TVTVRCGHCA 60 NLLYVNLRAL LLPPATAPAA ANHLPPFGQA LLSPTSPHGL LDAETMSSSS FQAPSLPSAE 120 PPSAACVSGI TSINNTACGG NNAASAMAPP PAKPALHEPP QLPRSAASAN KTSEKRQRVP 180 SAYNRFIKDE IQRIKASNPD ITHREAFSAA AKNWAHFPHI HFGLMPDQGL KKHPMQTQEG 240 AECMLFKDGL YAAAAAATAA SSMGISPF |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.98944 | 0.0 | meristem| shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G005353 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaf primordia, young leaves, floret meristems, floral organ primordia, stamens and carpels. Does not show polar expression pattern. {ECO:0000269|PubMed:17216490, ECO:0000269|PubMed:17351053}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000250}. | |||||
UniProt | May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000269|PubMed:17351053}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G005353_P01 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by WOX3. {ECO:0000269|PubMed:17351053}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY313901 | 0.0 | AY313901.1 Zea mays yabby14 protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001105230.1 | 0.0 | yabby14 | ||||
Swissprot | Q01JG2 | 1e-109 | YAB5_ORYSI; Protein YABBY 5 | ||||
Swissprot | Q0JBF0 | 1e-109 | YAB5_ORYSJ; Protein YABBY 5 | ||||
TrEMBL | Q7X9M9 | 0.0 | Q7X9M9_MAIZE; Yabby14 protein | ||||
STRING | GRMZM2G005353_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1445 | 38 | 121 | Representative plant | OGRP17343 | 2 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45190.1 | 3e-40 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G005353_P01 |
Entrez Gene | 542128 |
Publications ? help Back to Top | |||
---|---|---|---|
|