PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G45190.1

Common Name

AFO, AT, F4L23.30, FIL, YAB1

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

YABBY

Protein Properties

Length: 229aa MW: 25779.4 Da PI: 7.274

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G45190.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	282.6	4e-87	17	189	2	170
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee.......lleelkveeenlksnvekeesa 92 d+fs s+++CyvqCnfC+tilav+vP+tslfk+vtvrCG+Ct+lls ++++s++l+a+++l+ +l ++ +leel+++ +n+++++++++ + AT2G45190.1 17 DHFSPSDHLCYVQCNFCQTILAVNVPYTSLFKTVTVRCGCCTNLLS--VNMRSYVLPASNQLQLQLGPHsyfnpqdILEELRDAPSNMNMMMMNQHPT 112 899*****************************************..66889***************************************** PP YABBY 93 stsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 +++++s+ ++ ++++e+p++ppv+rPPekrqrvPsaynrfikeeiqrika+nPdishreafsaaaknWahfP+ihfgl AT2G45190.1 113 MNDIPSF-MDLHQQHEIPKAPPVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 189 **6.5*****************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	1.4E-70	21	189	IPR006780	YABBY protein
SuperFamily	SSF47095	7.46E-8	135	182	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	8.4E-5	137	183	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009909	Biological Process	regulation of flower development
GO:0009933	Biological Process	meristem structural organization
GO:0009944	Biological Process	polarity specification of adaxial/abaxial axis
GO:0010093	Biological Process	specification of floral organ identity
GO:0010154	Biological Process	fruit development
GO:0010158	Biological Process	abaxial cell fate specification
GO:0010159	Biological Process	specification of organ position
GO:0010450	Biological Process	inflorescence meristem growth
GO:1902183	Biological Process	regulation of shoot apical meristem development
GO:2000024	Biological Process	regulation of leaf development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0046872	Molecular Function	metal ion binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000293	anatomy	guard cell
PO:0006019	anatomy	leaf abaxial epidermis
PO:0008019	anatomy	leaf lamina base
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 229 aa Download sequence Send to blast
MSMSSMSSPS SAVCSPDHFS PSDHLCYVQC NFCQTILAVN VPYTSLFKTV TVRCGCCTNL 60 LSVNMRSYVL PASNQLQLQL GPHSYFNPQD ILEELRDAPS NMNMMMMNQH PTMNDIPSFM 120 DLHQQHEIPK APPVNRPPEK RQRVPSAYNR FIKEEIQRIK AGNPDISHRE AFSAAAKNWA 180 HFPHIHFGLV PDNQPVKKTN MPQQEGEDNM VMKEGFYAPA AANVGVTPY

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	245138_at	0.0
Expression Atlas	AT2G45190	-
AtGenExpress	AT2G45190	-
ATTED-II	AT2G45190	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo the expression starts during the transition between globular and heart stages in the cotyledon anlagen. From the heart stage, expression expands to abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269\|PubMed:10457020}.
Uniprot	TISSUE SPECIFICITY: Expressed in abaxial regions of young lateral aerial organs, and in primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269\|PubMed:10323860, ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:14555697, ECO:0000269\|Ref.3}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of the YABBY family of transcriptional regulators that is involved in abaxial cell type specification in leaves and fruits. YAB1 acts in a non-cell autonomous fashion within the meristem to affect phyllotactic patterning. The non-autonomous effect on the central region of the meristem is mediated through the activity if Lateral Suppressor (LAS).
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269\|PubMed:10323860, ECO:0000269\|PubMed:10331982, ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:11812777, ECO:0000269\|PubMed:12417699, ECO:0000269\|PubMed:19837869, ECO:0000269\|PubMed:9878633, ECO:0000269\|Ref.3, ECO:0000269\|Ref.6}.

Function -- GeneRIF ? help Back to Top
AINTEGUMENTA acts in combination with FILAMENTOUS FLOWER to promote organ polarity by up-regulating the expression of the adaxial-specifying HD-ZIP gene PHABULOSA. [PMID: 16714408] Results suggest that YAB1 activity stimulates signals from the organs to the meristem via a secondary message or signal cascade, a process essential for organized growth of the SAM. [PMID: 18469164] Analysis of FIL truncations revealed that the first 109 residues of the protein are required for LUG/LUH interactions [PMID: 19837869] FIL/YAB1 was exclusively expressed in trichome cells [PMID: 20101514] fil-9 allele mutant flowers show a wide range of organ morphological and identity defects. [PMID: 20584289] Mutation of these YAB and KNOX1 genes together causes nearly complete suppression of bop1 bop2 ectopic organ outgrowth at the morphological and cellular levels. [PMID: 20610407] FIL functions as a transcriptional activator in plants and that this activity is involved in leaf patterning. [PMID: 23025792] JAZ3 interacts with YABs to attenuate their transcriptional function. [PMID: 26530088] BREVIPEDICELLUS (BP) encodes a class-I KNOTTED1-like homeobox (KNOX) transcription factor. FIL acts to oppose KNOX1 gene function through a complex regulatory network that involves changes in secondary metabolites and auxin. [PMID: 28493925]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00620	PBM	24477691	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G45190.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G65620 (R), AT2G33860 (A), AT2G34710 (A), AT2G37630 (R), AT3G44750 (A), AT4G37750 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G69120(A), AT2G34710(A), AT2G42830(A), AT4G18960(R), AT5G60910(A)

Interaction -- BIND ? help Back to Top
Source	Intact With	Description
BIND	AT4G27330	NZZ interacts with FIL.

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT4G27330
IntAct	Search O22152

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Leaves polarity and growth defects. {ECO:0000269\|PubMed:19837869}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G45190

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF074948	0.0	AF074948.1 Arabidopsis thaliana FIL mRNA, complete cds.
GenBank	AF087015	0.0	AF087015.1 Arabidopsis thaliana abnormal floral organs protein (AFO) mRNA, complete cds.
GenBank	AF136538	0.0	AF136538.1 Arabidopsis thaliana YABBY1 (YABBY1) mRNA, complete cds.
GenBank	BT026409	0.0	BT026409.1 Arabidopsis thaliana At2g45190 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_566037.1	1e-173	Plant-specific transcription factor YABBY family protein
Swissprot	O22152	1e-174	YAB1_ARATH; Axial regulator YABBY 1
TrEMBL	A0A384LM25	1e-172	A0A384LM25_ARATH; YAB1
TrEMBL	Q0V811	1e-172	Q0V811_ARATH; At2g45190
STRING	AT2G45190.1	1e-172	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2217	28	77
Representative plant	OGRP4685	11	23

Link Out ? help Back to Top
Phytozome	AT2G45190.1
Entrez Gene	819127
iHOP	AT2G45190
wikigenes	AT2G45190

Publications ? help Back to Top
Sawa S, et al. FILAMENTOUS FLOWER, a meristem and organ identity gene of Arabidopsis, encodes a protein with a zinc finger and HMG-related domains. Genes Dev., 1999. 13(9): p. 1079-88 [PMID:10323860] Chen Q, et al. The Arabidopsis FILAMENTOUS FLOWER gene is required for flower formation. Development, 1999. 126(12): p. 2715-26 [PMID:10331982] Siegfried KR, et al. Members of the YABBY gene family specify abaxial cell fate in Arabidopsis. Development, 1999. 126(18): p. 4117-28 [PMID:10457020] Yang WC,Ye D,Xu J,Sundaresan V The SPOROCYTELESS gene of Arabidopsis is required for initiation of sporogenesis and encodes a novel nuclear protein. Genes Dev., 1999. 13(16): p. 2108-17 [PMID:10465788] Bowman JL The YABBY gene family and abaxial cell fate. Curr. Opin. Plant Biol., 2000. 3(1): p. 17-22 [PMID:10679447] Kanaya E,Watanabe K,Nakajima N,Okada K,Shimura Y Zinc release from the CH2C6 zinc finger domain of FILAMENTOUS FLOWER protein from Arabidopsis thaliana induces self-assembly. J. Biol. Chem., 2001. 276(10): p. 7383-90 [PMID:11092895] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Eshed Y,Baum SF,Perea JV,Bowman JL Establishment of polarity in lateral organs of plants. Curr. Biol., 2001. 11(16): p. 1251-60 [PMID:11525739] Kanaya E,Nakajima N,Okada K Non-sequence-specific DNA binding by the FILAMENTOUS FLOWER protein from Arabidopsis thaliana is reduced by EDTA. J. Biol. Chem., 2002. 277(14): p. 11957-64 [PMID:11812777] Kumaran MK,Bowman JL,Sundaresan V YABBY polarity genes mediate the repression of KNOX homeobox genes in Arabidopsis. Plant Cell, 2002. 14(11): p. 2761-70 [PMID:12417699] Lin WC,Shuai B,Springer PS The Arabidopsis LATERAL ORGAN BOUNDARIES-domain gene ASYMMETRIC LEAVES2 functions in the repression of KNOX gene expression and in adaxial-abaxial patterning. Plant Cell, 2003. 15(10): p. 2241-52 [PMID:14508003] Watanabe K,Okada K Two discrete cis elements control the Abaxial side-specific expression of the FILAMENTOUS FLOWER gene in Arabidopsis. Plant Cell, 2003. 15(11): p. 2592-602 [PMID:14555697] Sieber P,Petrascheck M,Barberis A,Schneitz K Organ polarity in Arabidopsis. NOZZLE physically interacts with members of the YABBY family. Plant Physiol., 2004. 135(4): p. 2172-85 [PMID:15299139] Meister RJ,Oldenhof H,Bowman JL,Gasser CS Multiple protein regions contribute to differential activities of YABBY proteins in reproductive development. Plant Physiol., 2005. 137(2): p. 651-62 [PMID:15665244] Dinneny JR,Weigel D,Yanofsky MF A genetic framework for fruit patterning in Arabidopsis thaliana. Development, 2005. 132(21): p. 4687-96 [PMID:16192305] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Franks RG,Liu Z,Fischer RL SEUSS and LEUNIG regulate cell proliferation, vascular development and organ polarity in Arabidopsis petals. Planta, 2006. 224(4): p. 801-11 [PMID:16625397] Garcia D,Collier SA,Byrne ME,Martienssen RA Specification of leaf polarity in Arabidopsis via the trans-acting siRNA pathway. Curr. Biol., 2006. 16(9): p. 933-8 [PMID:16682355] Xu L, et al. Genetic interaction between the AS1-AS2 and RDR6-SGS3-AGO7 pathways for leaf morphogenesis. Plant Cell Physiol., 2006. 47(7): p. 853-63 [PMID:16699177] Nole-Wilson S,Krizek BA AINTEGUMENTA contributes to organ polarity and regulates growth of lateral organs in combination with YABBY genes. Plant Physiol., 2006. 141(3): p. 977-87 [PMID:16714408] Balanz Patterning the female side of Arabidopsis: the importance of hormones. J. Exp. Bot., 2006. 57(13): p. 3457-69 [PMID:17023565] Huang W, et al. The proteolytic function of the Arabidopsis 26S proteasome is required for specifying leaf adaxial identity. Plant Cell, 2006. 18(10): p. 2479-92 [PMID:17028202] Ueno Y, et al. Histone deacetylases and ASYMMETRIC LEAVES2 are involved in the establishment of polarity in leaves of Arabidopsis. Plant Cell, 2007. 19(2): p. 445-57 [PMID:17293570] Dai M,Hu Y,Zhao Y,Liu H,Zhou DX A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development. Plant Physiol., 2007. 144(1): p. 380-90 [PMID:17351053] Fu Y, et al. Genetic interactions between leaf polarity-controlling genes and ASYMMETRIC LEAVES1 and 2 in Arabidopsis leaf patterning. Plant Cell Physiol., 2007. 48(5): p. 724-35 [PMID:17395603] Ha CM,Jun JH,Nam HG,Fletcher JC BLADE-ON-PETIOLE 1 and 2 control Arabidopsis lateral organ fate through regulation of LOB domain and adaxial-abaxial polarity genes. Plant Cell, 2007. 19(6): p. 1809-25 [PMID:17601823] Gordon SP, et al. Pattern formation during de novo assembly of the Arabidopsis shoot meristem. Development, 2007. 134(19): p. 3539-48 [PMID:17827180] Azhakanandam S,Nole-Wilson S,Bao F,Franks RG SEUSS and AINTEGUMENTA mediate patterning and ovule initiation during gynoecium medial domain development. Plant Physiol., 2008. 146(3): p. 1165-81 [PMID:18184731] Goldshmidt A,Alvarez JP,Bowman JL,Eshed Y Signals derived from YABBY gene activities in organ primordia regulate growth and partitioning of Arabidopsis shoot apical meristems. Plant Cell, 2008. 20(5): p. 1217-30 [PMID:18469164] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Meng C,Chen J,Ding SW,Peng J,Wong SM Hibiscus chlorotic ringspot virus coat protein inhibits trans-acting small interfering RNA biogenesis in Arabidopsis. J. Gen. Virol., 2008. 89(Pt 9): p. 2349-58 [PMID:18753245] Mummenhoff K,Polster A,M Lepidium as a model system for studying the evolution of fruit development in Brassicaceae. J. Exp. Bot., 2009. 60(5): p. 1503-13 [PMID:19052256] Girin T,Sorefan K,Ostergaard L Meristematic sculpting in fruit development. J. Exp. Bot., 2009. 60(5): p. 1493-502 [PMID:19246597] Alvarez JP,Goldshmidt A,Efroni I,Bowman JL,Eshed Y The NGATHA distal organ development genes are essential for style specification in Arabidopsis. Plant Cell, 2009. 21(5): p. 1373-93 [PMID:19435933] Stahle MI,Kuehlich J,Staron L,von Arnim AG,Golz JF YABBYs and the transcriptional corepressors LEUNIG and LEUNIG_HOMOLOG maintain leaf polarity and meristem activity in Arabidopsis. Plant Cell, 2009. 21(10): p. 3105-18 [PMID:19837869] Colombo M, et al. A new role for the SHATTERPROOF genes during Arabidopsis gynoecium development. Dev. Biol., 2010. 337(2): p. 294-302 [PMID:19900437] Schliep M,Ebert B,Simon-Rosin U,Zoeller D,Fisahn J Quantitative expression analysis of selected transcription factors in pavement, basal and trichome cells of mature leaves from Arabidopsis thaliana. Protoplasma, 2010. 241(1-4): p. 29-36 [PMID:20101514] Tononi P,M GRAMINIFOLIA homolog expression in Streptocarpus rexii is associated with the basal meristems in phyllomorphs, a morphological novelty in Gesneriaceae. Evol. Dev., 2010 Jan-Feb. 12(1): p. 61-73 [PMID:20156283] Lugassi N,Nakayama N,Bochnik R,Zik M A novel allele of FILAMENTOUS FLOWER reveals new insights on the link between inflorescence and floral meristem organization and flower morphogenesis. BMC Plant Biol., 2010. 10: p. 131 [PMID:20584289] Ha CM,Jun JH,Fletcher JC Control of Arabidopsis leaf morphogenesis through regulation of the YABBY and KNOX families of transcription factors. Genetics, 2010. 186(1): p. 197-206 [PMID:20610407] Szakonyi D,Byrne ME Ribosomal protein L27a is required for growth and patterning in Arabidopsis thaliana. Plant J., 2011. 65(2): p. 269-81 [PMID:21223391] Szakonyi D,Byrne ME Involvement of ribosomal protein RPL27a in meristem activity and organ development. Plant Signal Behav, 2011. 6(5): p. 712-4 [PMID:21448008] Liu Z,Jia L,Wang H,He Y HYL1 regulates the balance between adaxial and abaxial identity for leaf flattening via miRNA-mediated pathways. J. Exp. Bot., 2011. 62(12): p. 4367-81 [PMID:21610018] Toyokura K, et al. Succinic semialdehyde dehydrogenase is involved in the robust patterning of Arabidopsis leaves along the adaxial-abaxial axis. Plant Cell Physiol., 2011. 52(8): p. 1340-53 [PMID:21690177] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Bartholmes C,Hidalgo O,Gleissberg S Evolution of the YABBY gene family with emphasis on the basal eudicot Eschscholzia californica (Papaveraceae). Plant Biol (Stuttg), 2012. 14(1): p. 11-23 [PMID:21974722] Toyokura K,Hayashi M,Nishimura M,Okada K Adaxial-abaxial patterning: a novel function of the GABA shunt. Plant Signal Behav, 2012. 7(7): p. 705-7 [PMID:22751326] Vosnakis N, et al. A FILAMENTOUS FLOWER orthologue plays a key role in leaf patterning in opium poppy. Plant J., 2012. 72(4): p. 662-73 [PMID:22816617] Bonaccorso O,Lee JE,Puah L,Scutt CP,Golz JF FILAMENTOUS FLOWER controls lateral organ development by acting as both an activator and a repressor. BMC Plant Biol., 2012. 12: p. 176 [PMID:23025792] Gonz Antagonistic gene activities determine the formation of pattern elements along the mediolateral axis of the Arabidopsis fruit. PLoS Genet., 2012. 8(11): p. e1003020 [PMID:23133401] Xiang J, et al. Isolation and characterization of two VpYABBY genes from wild Chinese Vitis pseudoreticulata. Protoplasma, 2013. 250(6): p. 1315-25 [PMID:23728789] Lian H,Li X,Liu Z,He Y HYL1 is required for establishment of stamen architecture with four microsporangia in Arabidopsis. J. Exp. Bot., 2013. 64(11): p. 3397-410 [PMID:23918970] Tameshige T, et al. Pattern dynamics in adaxial-abaxial specific gene expression are modulated by a plastid retrograde signal during Arabidopsis thaliana leaf development. PLoS Genet., 2013. 9(7): p. e1003655 [PMID:23935517] Chen GH,Sun JY,Liu M,Liu J,Yang WC SPOROCYTELESS is a novel embryophyte-specific transcription repressor that interacts with TPL and TCP proteins in Arabidopsis. J Genet Genomics, 2014. 41(12): p. 617-25 [PMID:25527103] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Boter M, et al. FILAMENTOUS FLOWER Is a Direct Target of JAZ3 and Modulates Responses to Jasmonate. Plant Cell, 2015. 27(11): p. 3160-74 [PMID:26530088] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Tanaka W,Toriba T,Hirano HY Three TOB1-related YABBY genes are required to maintain proper function of the spikelet and branch meristems in rice. New Phytol., 2017. 215(2): p. 825-839 [PMID:28556940] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187] Sawa S,Ito T,Shimura Y,Okada K FILAMENTOUS FLOWER controls the formation and development of arabidopsis inflorescences and floral meristems. Plant Cell, 1999. 11(1): p. 69-86 [PMID:9878633]