PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015895038.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 171aa MW: 19745.4 Da PI: 10.0262 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 179.9 | 6.5e-56 | 9 | 134 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrFhPtdeel+v+yLk++++++++++ ++i+evdiyk++Pw+Lp+k++++e+ewyfFs+r++ky++g r+nrat sgyWkatg+dk+++s XP_015895038.1 9 LPPGFRFHPTDEELIVYYLKNQATSRPCPV-SIIPEVDIYKFDPWELPEKAESGENEWYFFSPRERKYPNGVRPNRATVSGYWKATGTDKAIYS- 101 79****************************.89***************99999*****************************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ vg+kk+Lvfykgr pkg ktdW+mheyrl XP_015895038.1 102 GSKYVGVKKSLVFYKGRPPKGLKTDWIMHEYRL 134 999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.23E-62 | 5 | 139 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.48 | 9 | 154 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.3E-28 | 10 | 134 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009825 | Biological Process | multidimensional cell growth | ||||
GO:0009835 | Biological Process | fruit ripening | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
METKRGSELP PGFRFHPTDE ELIVYYLKNQ ATSRPCPVSI IPEVDIYKFD PWELPEKAES 60 GENEWYFFSP RERKYPNGVR PNRATVSGYW KATGTDKAIY SGSKYVGVKK SLVFYKGRPP 120 KGLKTDWIMH EYRLSDSRRQ INKHVGSMRD LQKEANGQTF GTKSGNFKSP I |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 3e-59 | 1 | 134 | 3 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00221 | DAP | Transfer from AT1G69490 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015895038.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015895037.1 | 1e-108 | NAC transcription factor 29 | ||||
Swissprot | K4BWV2 | 8e-91 | NAP1_SOLLC; NAC domain-containing protein 1 | ||||
TrEMBL | A0A2P5BZC6 | 1e-99 | A0A2P5BZC6_PARAD; NAC domain containing protein | ||||
TrEMBL | A0A2P5G0D6 | 1e-100 | A0A2P5G0D6_TREOI; NAC domain containing protein | ||||
STRING | XP_008221592.1 | 3e-96 | (Prunus mume) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 1e-92 | NAC-like, activated by AP3/PI |
Publications ? help Back to Top | |||
---|---|---|---|
|