PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G69490.1

Common Name

ANAC029, ATNAP, F10D13.14, NAC029, NAC29, NAP

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NAC

Protein Properties

Length: 268aa MW: 31425.7 Da PI: 6.8608

Description

NAC-like, activated by AP3/PI

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G69490.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	174.6	2.9e-54	9	134	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 lppGfrFhPtdeel+v+yL++++ +k++++ ++i+evdiyk++Pw+Lp+k++ +e+ewyfFs+r++ky++g r+nra+ sgyWkatg+dk+++s +++ AT1G69490.1 9 LPPGFRFHPTDEELIVYYLRNQTMSKPCPV-SIIPEVDIYKFDPWQLPEKTEFGENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHS-GSS 104 79**************************.89***********99999*************************************.999 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 +vg+kk Lvfykgr pkg ktdW+mheyrl AT1G69490.1 105 NVGVKKALVFYKGRPPKGIKTDWIMHEYRL 134 **************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.57E-65	4	161	IPR003441	NAC domain
PROSITE profile	PS51005	60.611	9	161	IPR003441	NAC domain
Pfam	PF02365	1.0E-26	10	134	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009825	Biological Process	multidimensional cell growth
GO:0009835	Biological Process	fruit ripening
GO:0009908	Biological Process	flower development
GO:0010150	Biological Process	leaf senescence
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0006081	anatomy	primary root apical meristem
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0020124	anatomy	root stele
PO:0020149	anatomy	quiescent center
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001026	developmental stage	D locules established stage
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 268 aa Download sequence Send to blast
MEVTSQSTLP PGFRFHPTDE ELIVYYLRNQ TMSKPCPVSI IPEVDIYKFD PWQLPEKTEF 60 GENEWYFFSP RERKYPNGVR PNRAAVSGYW KATGTDKAIH SGSSNVGVKK ALVFYKGRPP 120 KGIKTDWIMH EYRLHDSRKA STKRNGSMRL DEWVLCRIYK KRGASKLLNE QEGFMDEVLM 180 EDETKVVVNE AERRTEEEIM MMTSMKLPRT CSLAHLLEMD YMGPVSHIDN FSQFDHLHQP 240 DSESSWFGDL QFNQDEILNH HRQAMFKF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-71	5	166	13	170	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-71	5	166	13	170	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-71	5	166	13	170	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-71	5	166	13	170	NO APICAL MERISTEM PROTEIN
3swm_A	2e-71	5	166	16	173	NAC domain-containing protein 19
3swm_B	2e-71	5	166	16	173	NAC domain-containing protein 19
3swm_C	2e-71	5	166	16	173	NAC domain-containing protein 19
3swm_D	2e-71	5	166	16	173	NAC domain-containing protein 19
3swp_A	2e-71	5	166	16	173	NAC domain-containing protein 19
3swp_B	2e-71	5	166	16	173	NAC domain-containing protein 19
3swp_C	2e-71	5	166	16	173	NAC domain-containing protein 19
3swp_D	2e-71	5	166	16	173	NAC domain-containing protein 19
4dul_A	2e-71	5	166	13	170	NAC domain-containing protein 19
4dul_B	2e-71	5	166	13	170	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.24919	0.0	floral meristem\| leaf

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	13430577	0.0
Genevisible	256300_at	0.0
Expression Atlas	AT1G69490	-
AtGenExpress	AT1G69490	-
ATTED-II	AT1G69490	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed at the base of the inflorescence meristem and at late stages of development in petals and stamens. Up-regulated during leaf senescence. {ECO:0000269\|PubMed:16640597, ECO:0000269\|PubMed:9489703}.
Uniprot	TISSUE SPECIFICITY: Expressed in senescing leaves, petals and sepals. {ECO:0000269\|PubMed:16640597}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of the NAC transcription factor gene family. It is expressed in floral primordia and upregulated by AP3 and PI. Its expression is associated with leaf senescence.
UniProt	Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:16640597, ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:22184656, ECO:0000269\|PubMed:25516602}.

Function -- GeneRIF ? help Back to Top
Expression of AtNAP is closely associated with the senescence process of Arabidopsis rosette leaves. [PMID: 16640597] Arabidopsis silique senescence is highly controlled by AtNAP. Silique senescence is delayed and the respiration surge associated with endogenous or exogenous ethylene is suppressed in the atnap knockout mutant plants. [PMID: 23066145] NAP promotes chlorophyll degradation by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone ABA. [PMID: 25516602] NAP functions as a negative regulator in osmotic stress responses. NAP regulates AREB1 in salt stress response. [PMID: 27770200]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00221	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G69490.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269\|PubMed:22184656, ECO:0000269\|PubMed:24659488, ECO:0000269\|PubMed:25516602, ECO:0000269\|PubMed:9489703}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT3G54340 (A), AT5G20240 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT3G47340(A), AT5G15970(R), AT5G52310(R)

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: No visible phenotype, but delayed leaf senescence. {ECO:0000269\|PubMed:16640597}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G69490

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF360201	0.0	AF360201.1 Arabidopsis thaliana unknown protein (At1g69490) mRNA, complete cds.
GenBank	AY051015	0.0	AY051015.1 Arabidopsis thaliana unknown protein (At1g69490) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_564966.1	0.0	NAC-like, activated by AP3/PI
Swissprot	O49255	0.0	NAC29_ARATH; NAC transcription factor 29
TrEMBL	A0A178W8K0	0.0	A0A178W8K0_ARATH; NAP
STRING	AT1G69490.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7707	26	41
Representative plant	OGRP17	15	800

Link Out ? help Back to Top
Phytozome	AT1G69490.1
Entrez Gene	843282
iHOP	AT1G69490
wikigenes	AT1G69490

Publications ? help Back to Top
Kikuchi K, et al. Molecular analysis of the NAC gene family in rice. Mol. Gen. Genet., 2000. 262(6): p. 1047-51 [PMID:10660065] Ren T,Qu F,Morris TJ HRT gene function requires interaction between a NAC protein and viral capsid protein to confer resistance to turnip crinkle virus. Plant Cell, 2000. 12(10): p. 1917-26 [PMID:11041886] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Wu Y, et al. The abi1-1 mutation blocks ABA signaling downstream of cADPR action. Plant J., 2003. 34(3): p. 307-15 [PMID:12713537] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Ooka H, et al. Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana. DNA Res., 2003. 10(6): p. 239-47 [PMID:15029955] Nawy T, et al. Transcriptional profile of the Arabidopsis root quiescent center. Plant Cell, 2005. 17(7): p. 1908-25 [PMID:15937229] Guo Y,Gan S AtNAP, a NAC family transcription factor, has an important role in leaf senescence. Plant J., 2006. 46(4): p. 601-12 [PMID:16640597] Hurtado L,Farrona S,Reyes JC The putative SWI/SNF complex subunit BRAHMA activates flower homeotic genes in Arabidopsis thaliana. Plant Mol. Biol., 2006. 62(1-2): p. 291-304 [PMID:16845477] Bl Warm and cold parental reproductive environments affect seed properties, fitness, and cold responsiveness in Arabidopsis thaliana progenies. Plant Cell Environ., 2007. 30(2): p. 165-75 [PMID:17238908] Mara CD,Irish VF Two GATA transcription factors are downstream effectors of floral homeotic gene action in Arabidopsis. Plant Physiol., 2008. 147(2): p. 707-18 [PMID:18417639] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Kunieda T, et al. NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis. Plant Cell, 2008. 20(10): p. 2631-42 [PMID:18849494] Katari MS, et al. VirtualPlant: a software platform to support systems biology research. Plant Physiol., 2010. 152(2): p. 500-15 [PMID:20007449] Abdeen A,Schnell J,Miki B Transcriptome analysis reveals absence of unintended effects in drought-tolerant transgenic plants overexpressing the transcription factor ABF3. BMC Genomics, 2010. 11: p. 69 [PMID:20105335] Zhang K,Gan SS An abscisic acid-AtNAP transcription factor-SAG113 protein phosphatase 2C regulatory chain for controlling dehydration in senescing Arabidopsis leaves. Plant Physiol., 2012. 158(2): p. 961-9 [PMID:22184656] Vogelmann K, et al. Early senescence and cell death in Arabidopsis saul1 mutants involves the PAD4-dependent salicylic acid pathway. Plant Physiol., 2012. 159(4): p. 1477-87 [PMID:22706448] Kou X,Watkins CB,Gan SS Arabidopsis AtNAP regulates fruit senescence. J. Exp. Bot., 2012. 63(17): p. 6139-47 [PMID:23066145] Li DM,Wang JH,Peng SL,Zhu GF,L Molecular cloning and characterization of two novel NAC genes from Mikania micrantha (Asteraceae). Genet. Mol. Res., 2012. 11(4): p. 4383-401 [PMID:23079980] Zhang K,Halitschke R,Yin C,Liu CJ,Gan SS Salicylic acid 3-hydroxylase regulates Arabidopsis leaf longevity by mediating salicylic acid catabolism. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(36): p. 14807-12 [PMID:23959884] Kim HJ, et al. Gene regulatory cascade of senescence-associated NAC transcription factors activated by ETHYLENE-INSENSITIVE2-mediated leaf senescence signalling in Arabidopsis. J. Exp. Bot., 2014. 65(14): p. 4023-36 [PMID:24659488] Shinozaki Y, et al. Expression of an AtNAP gene homolog in senescing morning glory (Ipomoea nil) petals of two cultivars with a different flower life span. J. Plant Physiol., 2014. 171(8): p. 633-8 [PMID:24709156] Yang J,Worley E,Udvardi M A NAP-AAO3 regulatory module promotes chlorophyll degradation via ABA biosynthesis in Arabidopsis leaves. Plant Cell, 2014. 26(12): p. 4862-74 [PMID:25516602] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Huang D, et al. A Gibberellin-Mediated DELLA-NAC Signaling Cascade Regulates Cellulose Synthesis in Rice. Plant Cell, 2015. 27(6): p. 1681-96 [PMID:26002868] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription. Plant Cell Rep., 2016. 35(1): p. 155-66 [PMID:26441053] Seok HY, et al. Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response. Planta, 2017. 245(2): p. 329-341 [PMID:27770200] Sablowski RW,Meyerowitz EM A homolog of NO APICAL MERISTEM is an immediate target of the floral homeotic genes APETALA3/PISTILLATA. Cell, 1998. 92(1): p. 93-103 [PMID:9489703]