PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015893167.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 128aa MW: 14962 Da PI: 6.9738 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 106.9 | 2.5e-33 | 21 | 123 | 3 | 107 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 pGfrFhPt+eel+++yLk+ v g++l++ ++i ++iy+++PwdLp ++k +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+d++++s XP_015893167.1 21 PGFRFHPTEEELLDFYLKNMVMGSRLRF-DIIGFLNIYRHDPWDLPGMAKIGEREWYFFVPRDRKHGSGGRPNRTTEKGFWKATGSDRRIVS-LM 113 9*************************99.99***************888999**************************************99.44 PP NAM 98 elvglkktLv 107 e + L+ XP_015893167.1 114 ESSLYHEDLI 123 4445555555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.02E-37 | 19 | 114 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 34.882 | 19 | 128 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.8E-16 | 21 | 107 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MAAASSASNS MDEMTPELDL PGFRFHPTEE ELLDFYLKNM VMGSRLRFDI IGFLNIYRHD 60 PWDLPGMAKI GEREWYFFVP RDRKHGSGGR PNRTTEKGFW KATGSDRRIV SLMESSLYHE 120 DLIFVRIR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 2e-32 | 17 | 124 | 12 | 120 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015893167.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015893167.1 | 4e-91 | NAC domain-containing protein 22-like | ||||
Swissprot | Q10S65 | 6e-56 | NAC22_ORYSJ; NAC domain-containing protein 22 | ||||
TrEMBL | A0A2I4GZ82 | 3e-64 | A0A2I4GZ82_JUGRE; NAC domain-containing protein 35-like | ||||
STRING | XP_008382468.1 | 9e-64 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6214 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G17040.1 | 2e-59 | NAC domain containing protein 36 |
Publications ? help Back to Top | |||
---|---|---|---|
|