PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Previous version: v3.0 v4.0

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G17040.1

Common Name

anac036, NAC036

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NAC

Protein Properties

Length: 276aa MW: 31817.5 Da PI: 9.2526

Description

NAC domain containing protein 36

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G17040.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	150.5	7.9e-47	8	134	3	128
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kge 98 pGfrFhPt+eel+++yLk+ v gk+ ++ evi ++iy+++PwdLp + +e+ewyfF++r++k+ +g r++r+t++gyWkatg+d++++s ++ AT2G17040.1 8 PGFRFHPTEEELLDFYLKNMVYGKRSSV-EVIGFLNIYRHDPWDLPGLSRIGEREWYFFVPRERKHGNGGRPSRTTEKGYWKATGSDRKIISLsePKR 104 9**********************999.99***********7777899*********************************98755777 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 ++glkktLvfy+grap g+ktdWvm+e+r+ AT2G17040.1 105 VIGLKKTLVFYRGRAPGGSKTDWVMNEFRM 134 8*************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	53.859	6	152	IPR003441	NAC domain
SuperFamily	SSF101941	6.15E-56	7	152	IPR003441	NAC domain
Pfam	PF02365	1.2E-24	8	134	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009965	Biological Process	leaf morphogenesis
GO:0010200	Biological Process	response to chitin
GO:0045792	Biological Process	negative regulation of cell size
GO:0048281	Biological Process	inflorescence morphogenesis
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000014	anatomy	rosette leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 276 aa Download sequence Send to blast
MGKDIELPGF RFHPTEEELL DFYLKNMVYG KRSSVEVIGF LNIYRHDPWD LPGLSRIGER 60 EWYFFVPRER KHGNGGRPSR TTEKGYWKAT GSDRKIISLS EPKRVIGLKK TLVFYRGRAP 120 GGSKTDWVMN EFRMPDNCSL PKDVVLCKIY RKATSLKVLE QRAEMEAKMN QTCPNSPLSS 180 SETISFVGKE ENMMTSFRAP QVIAMEEANK IQMHQENAKT EEKQREAETK EPSSSLKLPF 240 GSLPELQLPK PGVEWDQLLS ISPWLQNLTP IVNIYW

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-44	8	155	19	168	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-44	8	155	19	168	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-44	8	155	19	168	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-44	8	155	19	168	NO APICAL MERISTEM PROTEIN
3swm_A	8e-45	8	155	22	171	NAC domain-containing protein 19
3swm_B	8e-45	8	155	22	171	NAC domain-containing protein 19
3swm_C	8e-45	8	155	22	171	NAC domain-containing protein 19
3swm_D	8e-45	8	155	22	171	NAC domain-containing protein 19
3swp_A	8e-45	8	155	22	171	NAC domain-containing protein 19
3swp_B	8e-45	8	155	22	171	NAC domain-containing protein 19
3swp_C	8e-45	8	155	22	171	NAC domain-containing protein 19
3swp_D	8e-45	8	155	22	171	NAC domain-containing protein 19
4dul_A	1e-44	8	155	19	168	NAC domain-containing protein 19
4dul_B	1e-44	8	155	19	168	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.28710	0.0	leaf

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145360021	0.0
Genevisible	263584_at	0.0
Expression Atlas	AT2G17040	-
AtGenExpress	AT2G17040	-
ATTED-II	AT2G17040	-

Functional Description ? help Back to Top
Source	Description
TAIR	Member of the NAC transcription factor family and more specifically, the ONAC022 subfamily. Involved in leaf and inflorescence stem morphogenesis.
UniProt	Transcription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269\|PubMed:26834774}.

Function -- GeneRIF ? help Back to Top
Semidwarf phenotype induced by overexpression of the ANAC036 gene [PMID: 19962211]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G17040.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269\|PubMed:26834774}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G17040

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF361804	0.0	AF361804.1 Arabidopsis thaliana At2g17040 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_565404.2	0.0	NAC domain containing protein 36
Swissprot	Q10S65	6e-86	NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBL	F4IME8	0.0	F4IME8_ARATH; NAC domain containing protein 36
STRING	AT2G17040.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3899	28	60
Representative plant	OGRP17	15	800

Link Out ? help Back to Top
Phytozome	AT2G17040.1
Entrez Gene	816209
iHOP	AT2G17040
wikigenes	AT2G17040

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Ooka H, et al. Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana. DNA Res., 2003. 10(6): p. 239-47 [PMID:15029955] Goda H, et al. Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis. Plant Physiol., 2004. 134(4): p. 1555-73 [PMID:15047898] Ko JH,Han KH,Park S,Yang J Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling. Plant Physiol., 2004. 135(2): p. 1069-83 [PMID:15194820] Hampton CR, et al. Cesium toxicity in Arabidopsis. Plant Physiol., 2004. 136(3): p. 3824-37 [PMID:15489280] Nagata T,Yamada H,Du Z,Todoriki S,Kikuchi S Microarray analysis of genes that respond to gamma-irradiation in Arabidopsis. J. Agric. Food Chem., 2005. 53(4): p. 1022-30 [PMID:15713015] Xin Z,Zhao Y,Zheng ZL Transcriptome analysis reveals specific modulation of abscisic acid signaling by ROP10 small GTPase in Arabidopsis. Plant Physiol., 2005. 139(3): p. 1350-65 [PMID:16258012] Mosher RA,Durrant WE,Wang D,Song J,Dong X A comprehensive structure-function analysis of Arabidopsis SNI1 defines essential regions and transcriptional repressor activity. Plant Cell, 2006. 18(7): p. 1750-65 [PMID:16766691] Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance. Plant Physiol., 2007. 144(3): p. 1391-406 [PMID:17478635] Libault M,Wan J,Czechowski T,Udvardi M,Stacey G Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11 [PMID:17722694] Meier S, et al. Co-expression and promoter content analyses assign a role in biotic and abiotic stress responses to plant natriuretic peptides. BMC Plant Biol., 2008. 8: p. 24 [PMID:18307823] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Kato H,Motomura T,Komeda Y,Saito T,Kato A Overexpression of the NAC transcription factor family gene ANAC036 results in a dwarf phenotype in Arabidopsis thaliana. J. Plant Physiol., 2010. 167(7): p. 571-7 [PMID:19962211] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]