![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zjn_sc00034.1.g06090.1.am.mk | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 180aa MW: 20092.2 Da PI: 6.9702 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 24.3 | 7.3e-08 | 15 | 52 | 3 | 38 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlk 38 +W++eEd+ + a +++ + +W+ Ia+ ++ gRt+ Zjn_sc00034.1.g06090.1.am.mk 15 PWSKEEDKVFESALVLWPDHtpdRWAMIAAQLP-GRTPT 52 8*****************99*************.***86 PP | |||||||
2 | Myb_DNA-binding | 45.3 | 2e-14 | 113 | 157 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W++eE+ l++++ +++G g+W+ I+r +Rt+ q+ s+ qky Zjn_sc00034.1.g06090.1.am.mk 113 PWSEEEHRLFLQGLEKYGRGDWRNISRFAVRTRTPTQVASHAQKY 157 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 8.598 | 8 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.31E-11 | 12 | 61 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.2E-5 | 12 | 64 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-6 | 13 | 59 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.20E-6 | 15 | 53 | No hit | No description |
Pfam | PF00249 | 6.2E-6 | 15 | 52 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.414 | 106 | 162 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.62E-17 | 107 | 161 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.0E-11 | 110 | 160 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 3.0E-17 | 110 | 161 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.7E-12 | 113 | 162 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.64E-11 | 113 | 158 | No hit | No description |
Pfam | PF00249 | 2.4E-12 | 113 | 157 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MEFHHHAGAA ATGRPWSKEE DKVFESALVL WPDHTPDRWA MIAAQLPGRT PTEAWEHYEA 60 LVADVDLIER GAVDVPGCWD AADDGGGGSE ESGPGRRAGS GRARGESRRP GIPWSEEEHR 120 LFLQGLEKYG RGDWRNISRF AVRTRTPTQV ASHAQKYFNR QLNPGSRDSK RKSIHDITTP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 2e-17 | 7 | 77 | 2 | 72 | RADIALIS |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HF679436 | 1e-141 | HF679436.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB30 protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002456680.1 | 1e-98 | transcription factor DIVARICATA | ||||
Swissprot | Q8S9H7 | 3e-50 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | C5XQK5 | 3e-97 | C5XQK5_SORBI; Uncharacterized protein | ||||
STRING | Sb03g040730.1 | 4e-98 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2895 | 36 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58900.1 | 3e-47 | Homeodomain-like transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|