PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00007.1.g11070.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 314aa    MW: 33719.4 Da    PI: 6.1235
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00007.1.g11070.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.4e-171562148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    +g W++eEde+l d ++++G g+W++ +++ g++R +k+c++rw +yl
  Zjn_sc00007.1.g11070.1.sm.mkhc 15 KGLWSPEEDEKLRDFIHRHGHGCWSALPAKAGLNRNGKSCRLRWINYL 62
                                    678*******************************************97 PP

2Myb_DNA-binding569.1e-1869113248
                                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                     g +++eE+e    +++ lG++ W+tIar+++ gRt++++k++w++yl
  Zjn_sc00007.1.g11070.1.sm.mkhc  69 GEFSPEEEETVMSLHAALGNK-WSTIARHLP-GRTDNEVKNYWNSYL 113
                                     78*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.5271062IPR017930Myb domain
SuperFamilySSF466891.36E-2912109IPR009057Homeodomain-like
SMARTSM007171.0E-131464IPR001005SANT/Myb domain
PfamPF002492.6E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-221669IPR009057Homeodomain-like
CDDcd001675.96E-121862No hitNo description
PROSITE profilePS5129425.45463117IPR017930Myb domain
SMARTSM007172.0E-1567115IPR001005SANT/Myb domain
PfamPF002491.1E-1569113IPR001005SANT/Myb domain
CDDcd001678.75E-1270113No hitNo description
Gene3DG3DSA:1.10.10.603.5E-2670117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGCKACEKPK PNYRKGLWSP EEDEKLRDFI HRHGHGCWSA LPAKAGLNRN GKSCRLRWIN  60
YLRPGLKHGE FSPEEEETVM SLHAALGNKW STIARHLPGR TDNEVKNYWN SYLKKRLEGR  120
EAGPSTPAPA PTATNSAADS DDSHQSVKPG ADGGTAPELP TDSGSSEPRE SSSVDSSCLT  180
GPHPAAAAAC RPQAPVAPKV MFADWLDMDM DYISGQVAAA PVLDSAGVVR ASASPSDHHQ  240
VVSVSQGSVR RQQQRVDGPC GVDVSSSVSL HGFGDSGAGC WEFQEQFDGM VDQMQPAGGF  300
CDLLTMTEFF AGLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25111183109B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794121e-140HF679412.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB6 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953256.11e-150transcription factor MYB4
SwissprotQ8LPH64e-53MYB86_ARATH; Transcription factor MYB86
TrEMBLK3YUK11e-149K3YUK1_SETIT; Uncharacterized protein
STRINGSi017947m1e-150(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.15e-55myb domain protein 19