PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G52260.1 | ||||||||
Common Name | AtMYB19, MYB19 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 268aa MW: 31178.7 Da PI: 7.6259 | ||||||||
Description | myb domain protein 19 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 36 | 1.6e-11 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEd++l+ + G +W+t++ g+ R +k+c++rw +yl AT5G52260.1 14 KGLWSPEEDQKLKSFILSRGHACWTTVPILAGLQRNGKSCRLRWINYL 61 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 55.5 | 1.3e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++++eE+e ++ ++ lG++ W++Ia++++ gRt++++k++w++yl AT5G52260.1 67 RGSFSEEEEETILTLHSSLGNK-WSRIAKYLP-GRTDNEIKNYWHSYL 112 899*******************.*********.************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.359 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.34E-27 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.2E-6 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.7E-10 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.1E-19 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.80E-5 | 17 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.982 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-16 | 67 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.5E-26 | 69 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.36E-7 | 78 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009005 | anatomy | root |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 268 aa Download sequence Send to blast |
MTKSGERPKQ RQRKGLWSPE EDQKLKSFIL SRGHACWTTV PILAGLQRNG KSCRLRWINY 60 LRPGLKRGSF SEEEEETILT LHSSLGNKWS RIAKYLPGRT DNEIKNYWHS YLKKRWLKSQ 120 PQLKSQISDL TESPSSLLSC GKRNLETETL DHVISFQKFS ENPTSSPSKE SNNNMIMNNS 180 NNLPKLFFSE WISSSNPHID YSSAFTDSKH INETQDQINE EEVMMINNNN YSSLEDVMLR 240 TDFLQPDHEY ANYYSSGDFF INSDQNYV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-25 | 14 | 115 | 7 | 107 | B-MYB |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 248343_at | 0.0 | ||||
Expression Atlas | AT5G52260 | - | ||||
AtGenExpress | AT5G52260 | - | ||||
ATTED-II | AT5G52260 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed at very low level. Expressed in cauline leaves. {ECO:0000269|PubMed:11581165}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Member of the R2R3 factor gene family. | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G52260.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G52260 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519636 | 0.0 | AY519636.1 Arabidopsis thaliana MYB transcription factor (At5g52260) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_200039.1 | 0.0 | myb domain protein 19 | ||||
Swissprot | Q9M0K4 | 1e-100 | LAF1_ARATH; Transcription factor LAF1 | ||||
TrEMBL | Q9LTJ5 | 0.0 | Q9LTJ5_ARATH; MYB transcription factor | ||||
STRING | AT5G52260.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G52260.1 |
Entrez Gene | 835302 |
iHOP | AT5G52260 |
wikigenes | AT5G52260 |