PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01027071001 | ||||||||
Common Name | LOC100258469, VIT_15s0046g01130, VITISV_033192 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 89aa MW: 10627.3 Da PI: 9.9415 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26.8 | 1.2e-08 | 30 | 69 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+++ k+ G + W++Ia +++ gR ++++ +w GSVIVT01027071001 30 MTEQEEDLIYRMYKLVGDR-WALIAGRIP-GRKAEEIERFWI 69 7****************99.*********.*********995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 7.1E-6 | 26 | 74 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.99E-5 | 29 | 68 | No hit | No description |
Pfam | PF00249 | 8.0E-8 | 30 | 69 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.03E-7 | 31 | 69 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 5.993 | 31 | 68 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-10 | 31 | 69 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MDRRRRKQAK THSSCCSEEV SSIAWEFINM TEQEEDLIYR MYKLVGDRWA LIAGRIPGRK 60 AEEIERFWIM RHGEGFAGIR KELKRYKF* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Ubiquitous in young leaves. Later, restricted to the leaf base in the trichome initiation zone. In mature leaves, confined to trichome cells. {ECO:0000269|PubMed:12356720}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, siliques and inflorescences. {ECO:0000269|PubMed:12356720}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM489324 | 4e-64 | AM489324.2 Vitis vinifera contig VV78X070152.6, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002281055.1 | 3e-59 | PREDICTED: transcription factor TRY | ||||
Refseq | XP_010661898.1 | 3e-59 | PREDICTED: transcription factor TRY | ||||
Swissprot | Q8GV05 | 5e-37 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A5CBT5 | 7e-58 | A5CBT5_VITVI; Uncharacterized protein | ||||
STRING | VIT_15s0046g01130.t01 | 1e-58 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP4207 | 8 | 23 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 2e-39 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01027071001 |
Entrez Gene | 100258469 |