PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G53200.1

Common Name

MFH8.14, TRY

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB_related

Protein Properties

Length: 106aa MW: 13005.6 Da PI: 9.9931

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G53200.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	25.7	2.7e-08	33	72	4	45
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+ + ++ G + W++Ia +++ gR ++++ +w AT5G53200.1 33 MTEQEEDLIFRMYRLVGDR-WDLIAGRVP-GRQPEEIERYWI 72 7**************99.*****.*********5 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	3.0E-6	29	77	IPR001005	SANT/Myb domain
CDD	cd00167	9.18E-6	32	71	No hit	No description
Pfam	PF00249	1.4E-7	33	72	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.88E-7	34	72	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	5.9E-10	34	72	IPR009057	Homeodomain-like
PROSITE profile	PS50090	6.307	34	71	IPR017877	Myb-like domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0007275	Biological Process	multicellular organism development
GO:0010091	Biological Process	trichome branching
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000263	anatomy	non-hair root epidermal cell
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MDNTDRRRRR KQHKIALHDS EEVSSIEWEF INMTEQEEDL IFRMYRLVGD RWDLIAGRVP 60 GRQPEEIERY WIMRNSEGFA DKRRQLHSSS HKHTKPHRPR FSIYPS

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.27502	0.0	bud\| inflorescence\| leaf

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30696296	0.0
Genevisible	248246_at	1e-143
Expression Atlas	AT5G53200	-
AtGenExpress	AT5G53200	-
ATTED-II	AT5G53200	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Ubiquitous in young leaves. Later, restricted to the leaf base in the trichome initiation zone. In mature leaves, confined to trichome cells. {ECO:0000269\|PubMed:12356720}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, leaves, siliques and inflorescences. {ECO:0000269\|PubMed:12356720}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269\|PubMed:10368181, ECO:0000269\|PubMed:12356720}.

Function -- GeneRIF ? help Back to Top
The TRY protein has specific properties relevant for cluster formation and trichome density. [PMID: 21951724] Mutations in CPC or TRY delay flowering of cpl3 plants. A mutation in ETC1 did not further delay flowering but reduced plant size. [PMID: 23796522] AtMYC1 is negative regulator of TRY. [PMID: 23900543] Data show that TRANSPARENT TESTA GLABRA 2 (TTG2) is a specific activator of TRYPTICHON protein (TRY) by binding to W-boxes in a minimal promoter fragment of TRY. [PMID: 25304203] TRY, but not the related factor CPC, is responsible for the preferential SCM accumulation. [PMID: 25482776] In an intricate interplay between three partly redundant single R3 MYB proteins, CPC, ETC1, and TRY regulate several developmental, physiological and metabolic processes that are putatively located in different tissues. [PMID: 26022254] that CPC, TRY and ETC1 are also involved in root hair formation at the root-hypocotyl junction. [PMID: 26339713] NTL8 negatively regulates trichome formation in Arabidopsis by directly activating the expression of TRY and TCL1. [PMID: 28649093] Study compared the functions of the wild-type TRY and ETC2 proteins and their amino acid-substituted versions. Results showed that the substitution of amino acids in the C-terminal of TRY and ETC2 conferred them the ability to induce root hair formation. Furthermore, results confirmed that these mutations enhanced the stability of the TRY and ETC2 proteins. [PMID: 30308079]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G53200.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269\|PubMed:12356720}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G63650 (A), AT1G79840 (A), AT2G42200 (A), AT2G46410 (R), AT3G27920 (A), AT5G14750 (A), AT5G40330 (A), AT5G41315 (A), AT5G53200 (R)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G79840(R), AT2G02480(R), AT2G37260(R), AT5G53200(R), AT5G65930(R)

Interaction -- BIND ? help Back to Top
Source	Intact With	Description
BIND	AT1G63650	EGL3 interacts with TRY.

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G63650
IntAct	Search Q8GV05

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G53200

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY161286	1e-180	AY161286.1 Arabidopsis thaliana TRIPTYCHON mRNA, complete cds.
GenBank	AY519523	1e-180	AY519523.1 Arabidopsis thaliana MYB transcription factor (At5g53200) mRNA, complete cds.
GenBank	BT024672	1e-180	BT024672.1 Arabidopsis thaliana unknown protein (At5g53200) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_200132.2	1e-73	Homeodomain-like superfamily protein
Swissprot	Q8GV05	1e-74	TRY_ARATH; Transcription factor TRY
TrEMBL	A0A178UFU9	3e-72	A0A178UFU9_ARATH; TRY
STRING	AT5G53200.1	4e-73	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM323	28	194
Representative plant	OGRP4207	8	23

Link Out ? help Back to Top
Phytozome	AT5G53200.1
Entrez Gene	835401
iHOP	AT5G53200
wikigenes	AT5G53200

Publications ? help Back to Top
Perazza D, et al. Trichome cell growth in Arabidopsis thaliana can be derepressed by mutations in at least five genes. Genetics, 1999. 152(1): p. 461-76 [PMID:10224275] Schnittger A,Folkers U,Schwab B,J Generation of a spacing pattern: the role of triptychon in trichome patterning in Arabidopsis. Plant Cell, 1999. 11(6): p. 1105-16 [PMID:10368181] Luo D,Oppenheimer DG Genetic control of trichome branch number in Arabidopsis: the roles of the FURCA loci. Development, 1999. 126(24): p. 5547-57 [PMID:10572032] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Schellmann S, et al. TRIPTYCHON and CAPRICE mediate lateral inhibition during trichome and root hair patterning in Arabidopsis. EMBO J., 2002. 21(19): p. 5036-46 [PMID:12356720] Scheres B Plant patterning: TRY to inhibit your neighbors. Curr. Biol., 2002. 12(23): p. R804-6 [PMID:12477405] Zhang F,Gonzalez A,Zhao M,Payne CT,Lloyd A A network of redundant bHLH proteins functions in all TTG1-dependent pathways of Arabidopsis. Development, 2003. 130(20): p. 4859-69 [PMID:12917293] Esch JJ, et al. A contradictory GLABRA3 allele helps define gene interactions controlling trichome development in Arabidopsis. Development, 2003. 130(24): p. 5885-94 [PMID:14561633] Serna L A network of interacting factors triggering different cell fates. Plant Cell, 2004. 16(9): p. 2258-63 [PMID:15342905] Montiel G,Gantet P,Jay-Allemand C,Breton C Transcription factor networks. Pathways to the knowledge of root development. Plant Physiol., 2004. 136(3): p. 3478-85 [PMID:15542499] Kirik V, et al. Functional diversification of MYB23 and GL1 genes in trichome morphogenesis and initiation. Development, 2005. 132(7): p. 1477-85 [PMID:15728674] Serna L Epidermal cell patterning and differentiation throughout the apical-basal axis of the seedling. J. Exp. Bot., 2005. 56(418): p. 1983-9 [PMID:15967776] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Kwak SH,Schiefelbein J The role of the SCRAMBLED receptor-like kinase in patterning the Arabidopsis root epidermis. Dev. Biol., 2007. 302(1): p. 118-31 [PMID:17027738] Ishida T, et al. Arabidopsis TRANSPARENT TESTA GLABRA2 is directly regulated by R2R3 MYB transcription factors and is involved in regulation of GLABRA2 transcription in epidermal differentiation. Plant Cell, 2007. 19(8): p. 2531-43 [PMID:17766401] Morohashi K, et al. Participation of the Arabidopsis bHLH factor GL3 in trichome initiation regulatory events. Plant Physiol., 2007. 145(3): p. 736-46 [PMID:17885086] Brininstool G, et al. Constitutive Expressor Of Pathogenesis-related Genes5 affects cell wall biogenesis and trichome development. BMC Plant Biol., 2008. 8: p. 58 [PMID:18485217] Wang S, et al. Comprehensive analysis of single-repeat R3 MYB proteins in epidermal cell patterning and their transcriptional regulation in Arabidopsis. BMC Plant Biol., 2008. 8: p. 81 [PMID:18644155] Digiuni S, et al. A competitive complex formation mechanism underlies trichome patterning on Arabidopsis leaves. Mol. Syst. Biol., 2008. 4: p. 217 [PMID:18766177] Jakoby MJ, et al. Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106. Plant Physiol., 2008. 148(3): p. 1583-602 [PMID:18805951] Ben Interlinked nonlinear subnetworks underlie the formation of robust cellular patterns in Arabidopsis epidermis: a dynamic spatial model. BMC Syst Biol, 2008. 2: p. 98 [PMID:19014692] Li SF, et al. The Arabidopsis MYB5 transcription factor regulates mucilage synthesis, seed coat development, and trichome morphogenesis. Plant Cell, 2009. 21(1): p. 72-89 [PMID:19136646] Wester K, et al. Functional diversity of R3 single-repeat genes in trichome development. Development, 2009. 136(9): p. 1487-96 [PMID:19336467] Kang YH, et al. The MYB23 gene provides a positive feedback loop for cell fate specification in the Arabidopsis root epidermis. Plant Cell, 2009. 21(4): p. 1080-94 [PMID:19395683] Serna L CAPRICE positively regulates stomatal formation in the Arabidopsis hypocotyl. Plant Signal Behav, 2008. 3(12): p. 1077-82 [PMID:19513241] Marks MD,Wenger JP,Gilding E,Jilk R,Dixon RA Transcriptome analysis of Arabidopsis wild-type and gl3-sst sim trichomes identifies four additional genes required for trichome development. Mol Plant, 2009. 2(4): p. 803-22 [PMID:19626137] Plett JM,Mathur J,Regan S Ethylene receptor ETR2 controls trichome branching by regulating microtubule assembly in Arabidopsis thaliana. J. Exp. Bot., 2009. 60(13): p. 3923-33 [PMID:19648171] Schliep M,Ebert B,Simon-Rosin U,Zoeller D,Fisahn J Quantitative expression analysis of selected transcription factors in pavement, basal and trichome cells of mature leaves from Arabidopsis thaliana. Protoplasma, 2010. 241(1-4): p. 29-36 [PMID:20101514] Xing S, et al. Disruption of the 1-deoxy-D-xylulose-5-phosphate reductoisomerase (DXR) gene results in albino, dwarf and defects in trichome initiation and stomata closure in Arabidopsis. Cell Res., 2010. 20(6): p. 688-700 [PMID:20404857] Yu N, et al. Temporal control of trichome distribution by microRNA156-targeted SPL genes in Arabidopsis thaliana. Plant Cell, 2010. 22(7): p. 2322-35 [PMID:20622149] Hanada K, et al. Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana. Mol. Biol. Evol., 2011. 28(1): p. 377-82 [PMID:20736450] Gilding EK,Marks MD Analysis of purified glabra3-shapeshifter trichomes reveals a role for NOECK in regulating early trichome morphogenic events. Plant J., 2010. 64(2): p. 304-17 [PMID:21070410] Niu Y, et al. Auxin modulates the enhanced development of root hairs in Arabidopsis thaliana (L.) Heynh. under elevated CO(2). Plant Cell Environ., 2011. 34(8): p. 1304-17 [PMID:21477123] Guan X, et al. Activation of Arabidopsis seed hair development by cotton fiber-related genes. PLoS ONE, 2011. 6(7): p. e21301 [PMID:21779324] Pesch M,H Role of TRIPTYCHON in trichome patterning in Arabidopsis. BMC Plant Biol., 2011. 11: p. 130 [PMID:21951724] Gan L,Xia K,Chen JG,Wang S Functional characterization of TRICHOMELESS2, a new single-repeat R3 MYB transcription factor in the regulation of trichome patterning in Arabidopsis. BMC Plant Biol., 2011. 11: p. 176 [PMID:22168948] Bruex A, et al. A gene regulatory network for root epidermis cell differentiation in Arabidopsis. PLoS Genet., 2012. 8(1): p. e1002446 [PMID:22253603] Zhao H, et al. A single amino acid substitution in IIIf subfamily of basic helix-loop-helix transcription factor AtMYC1 leads to trichome and root hair patterning defects by abolishing its interaction with partner proteins in Arabidopsis. J. Biol. Chem., 2012. 287(17): p. 14109-21 [PMID:22334670] Tominaga-Wada R,Nukumizu Y Expression analysis of an R3-Type MYB transcription factor CPC-LIKE MYB4 (TRICHOMELESS2) and CPL4-Related transcripts in Arabidopsis. Int J Mol Sci, 2012. 13(3): p. 3478-91 [PMID:22489163] Nukumizu Y,Wada T,Tominaga-Wada R Tomato (Solanum lycopersicum) homologs of TRIPTYCHON (SlTRY) and GLABRA3 (SlGL3) are involved in anthocyanin accumulation. Plant Signal Behav, 2013. 8(7): p. e24575 [PMID:23603939] Wang G,Zhao GH,Jia YH,Du XM Identification and characterization of cotton genes involved in fuzz-fiber development. J Integr Plant Biol, 2013. 55(7): p. 619-30 [PMID:23710824] Tominaga-Wada R,Nukumizu Y,Wada T Flowering is delayed by mutations in homologous genes CAPRICE and TRYPTICHON in the early flowering Arabidopsis cpl3 mutant. J. Plant Physiol., 2013. 170(16): p. 1466-8 [PMID:23796522] Pesch M,Schulthei Mutual control of intracellular localisation of the patterning proteins AtMYC1, GL1 and TRY/CPC in Arabidopsis. Development, 2013. 140(16): p. 3456-67 [PMID:23900543] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xue XY, et al. Interaction between two timing microRNAs controls trichome distribution in Arabidopsis. PLoS Genet., 2014. 10(4): p. e1004266 [PMID:24699192] Nayidu NK, et al. Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae. PLoS ONE, 2014. 9(4): p. e95877 [PMID:24755905] Pesch M,Dartan B,Birkenbihl R,Somssich IE,H Arabidopsis TTG2 regulates TRY expression through enhancement of activator complex-triggered activation. Plant Cell, 2014. 26(10): p. 4067-83 [PMID:25304203] Taheri A, et al. A landscape of hairy and twisted: hunting for new trichome mutants in the Saskatoon Arabidopsis T-DNA population. Plant Biol (Stuttg), 2015. 17(2): p. 384-94 [PMID:25348773] Kwak SH,Schiefelbein J TRIPTYCHON, not CAPRICE, participates in feedback regulation of SCM expression in the Arabidopsis root epidermis. Plant Signal Behav, 2014. 9(11): p. e973815 [PMID:25482776] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Chen CY,Schmidt W The paralogous R3 MYB proteins CAPRICE, TRIPTYCHON and ENHANCER OF TRY AND CPC1 play pleiotropic and partly non-redundant roles in the phosphate starvation response of Arabidopsis roots. J. Exp. Bot., 2015. 66(15): p. 4821-34 [PMID:26022254] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Tian H, et al. NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1. Plant Physiol., 2017. 174(4): p. 2363-2375 [PMID:28649093] Tominaga-Wada R,Wada T Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308] Yamada K,Sasabe M,Fujikawa Y,Wada T,Tominaga-Wada R Amino acid substitutions in CPC-LIKE MYB reveal residues important for protein stability in Arabidopsis roots. PLoS ONE, 2018. 13(10): p. e0205522 [PMID:30308079] Kribii R, et al. Cloning and characterization of the Arabidopsis thaliana SQS1 gene encoding squalene synthase--involvement of the C-terminal region of the enzyme in the channeling of squalene through the sterol pathway. Eur. J. Biochem., 1997. 249(1): p. 61-9 [PMID:9363754] Szymanski DB,Marks MD GLABROUS1 overexpression and TRIPTYCHON alter the cell cycle and trichome cell fate in Arabidopsis. Plant Cell, 1998. 10(12): p. 2047-62 [PMID:9836744]