PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01026055001 | ||||||||
Common Name | LOC100263202, VIT_18s0041g00700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 226aa MW: 26238.6 Da PI: 8.9381 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 149.7 | 1.5e-46 | 4 | 136 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkklel.eevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 lppGfrF Pt+eelv++yL+ k++gk+l++ ++vi++v+iy++ePw+Lp+ ++ ++++w+fF++r+ ++ +g r++r+t sgyWkatg GSVIVT01026055001 4 LPPGFRFYPTEEELVSFYLRMKLQGKRLQElNRVIPDVNIYELEPWHLPRlsgeVCRRDTEQWFFFIPRQAREVQGGRPSRTTGSGYWKATG 95 79*************************7661556**************9546654445677******************************* PP NAM 88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + v+s++++++g+kkt+vfy+g+ap g+kt+W m+eyr+ GSVIVT01026055001 96 SPSYVYSSDNRVIGVKKTMVFYNGKAPAGRKTKWKMQEYRA 136 ***************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.7E-48 | 3 | 155 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 48.548 | 4 | 157 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.9E-24 | 5 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 226 aa Download sequence Send to blast |
MEDLPPGFRF YPTEEELVSF YLRMKLQGKR LQELNRVIPD VNIYELEPWH LPRLSGEVCR 60 RDTEQWFFFI PRQAREVQGG RPSRTTGSGY WKATGSPSYV YSSDNRVIGV KKTMVFYNGK 120 APAGRKTKWK MQEYRAIEAD ATPKLRHEFS LSRVYVISGS FRAFDRRPLG TVTREETSQQ 180 DTQMMEKRSS SPECSYSGGY DHVHLQASSA PIDDFLWDWG QLDWL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-35 | 4 | 155 | 17 | 163 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-35 | 4 | 155 | 17 | 163 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-35 | 4 | 155 | 17 | 163 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-35 | 4 | 155 | 17 | 163 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-35 | 4 | 155 | 20 | 166 | NAC domain-containing protein 19 |
3swm_B | 4e-35 | 4 | 155 | 20 | 166 | NAC domain-containing protein 19 |
3swm_C | 4e-35 | 4 | 155 | 20 | 166 | NAC domain-containing protein 19 |
3swm_D | 4e-35 | 4 | 155 | 20 | 166 | NAC domain-containing protein 19 |
3swp_A | 4e-35 | 4 | 155 | 20 | 166 | NAC domain-containing protein 19 |
3swp_B | 4e-35 | 4 | 155 | 20 | 166 | NAC domain-containing protein 19 |
3swp_C | 4e-35 | 4 | 155 | 20 | 166 | NAC domain-containing protein 19 |
3swp_D | 4e-35 | 4 | 155 | 20 | 166 | NAC domain-containing protein 19 |
4dul_A | 5e-35 | 4 | 155 | 17 | 163 | NAC domain-containing protein 19 |
4dul_B | 5e-35 | 4 | 155 | 17 | 163 | NAC domain-containing protein 19 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM457683 | 1e-143 | AM457683.1 Vitis vinifera contig VV78X133673.15, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002266232.1 | 1e-164 | PREDICTED: NAC domain-containing protein 90 | ||||
Swissprot | Q9FMR3 | 1e-88 | NAC90_ARATH; NAC domain-containing protein 90 | ||||
TrEMBL | F6I3Y7 | 1e-162 | F6I3Y7_VITVI; Uncharacterized protein | ||||
STRING | VIT_18s0041g00700.t01 | 1e-163 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP2278 | 11 | 36 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G22380.1 | 5e-91 | NAC domain containing protein 90 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01026055001 |
Entrez Gene | 100263202 |
Publications ? help Back to Top | |||
---|---|---|---|
|