![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G22380.1 | ||||||||
Common Name | anac090, MWD9.18, NAC090 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 235aa MW: 26722 Da PI: 5.7675 | ||||||||
Description | NAC domain containing protein 90 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 139.2 | 2.6e-43 | 6 | 137 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 + GfrF Pt+eelv++yL++++eg++ ++++vi+ +d+++veP++Lp+ +++++ ++w+fF++r++++a+g r++r+t sgyWkatg+ +v+s AT5G22380.1 6 TIGFRFYPTEEELVSFYLRNQLEGRSdDSMHRVIPVLDVFEVEPSHLPNvagvRCRGDAEQWFFFVPRQEREARGGRPSRTTGSGYWKATGSPGPVFS 103 57***********************95555677***************556666666888************************************** PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 k+++ +g kkt+vfy+g+ap+g+kt+W m+ey++ AT5G22380.1 104 KDNKMIGAKKTMVFYTGKAPTGRKTKWKMNEYHA 137 ********************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 46.963 | 5 | 162 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 3.4E-47 | 5 | 161 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.0E-23 | 7 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 235 aa Download sequence Send to blast |
MADEVTIGFR FYPTEEELVS FYLRNQLEGR SDDSMHRVIP VLDVFEVEPS HLPNVAGVRC 60 RGDAEQWFFF VPRQEREARG GRPSRTTGSG YWKATGSPGP VFSKDNKMIG AKKTMVFYTG 120 KAPTGRKTKW KMNEYHAVDE TVNASTIPKL RREFSLCRVY ITTGSSRAFD RRPEGVLQTE 180 RMLTSDVAVA ETSFRVESSL ETSISGGEHI DVSMNTEFVD GLSEPMWDWE QLTWP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 1e-31 | 8 | 167 | 23 | 173 | NAC domain-containing protein 19 |
3swm_B | 1e-31 | 8 | 167 | 23 | 173 | NAC domain-containing protein 19 |
3swm_C | 1e-31 | 8 | 167 | 23 | 173 | NAC domain-containing protein 19 |
3swm_D | 1e-31 | 8 | 167 | 23 | 173 | NAC domain-containing protein 19 |
3swp_A | 1e-31 | 8 | 167 | 23 | 173 | NAC domain-containing protein 19 |
3swp_B | 1e-31 | 8 | 167 | 23 | 173 | NAC domain-containing protein 19 |
3swp_C | 1e-31 | 8 | 167 | 23 | 173 | NAC domain-containing protein 19 |
3swp_D | 1e-31 | 8 | 167 | 23 | 173 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 249940_at | 0.0 | ||||
Expression Atlas | AT5G22380 | - | ||||
AtGenExpress | AT5G22380 | - | ||||
ATTED-II | AT5G22380 | - |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G22380.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G22380 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK175806 | 0.0 | AK175806.1 Arabidopsis thaliana mRNA for NAC-domain protein-like, complete cds, clone: RAFL22-40-G20. | |||
GenBank | AY086944 | 0.0 | AY086944.1 Arabidopsis thaliana clone 29829 mRNA, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_197630.1 | 1e-175 | NAC domain containing protein 90 | ||||
Swissprot | Q9FMR3 | 1e-176 | NAC90_ARATH; NAC domain-containing protein 90 | ||||
TrEMBL | A0A384LFC9 | 1e-174 | A0A384LFC9_ARATH; NAC090 | ||||
TrEMBL | Q680R1 | 1e-174 | Q680R1_ARATH; NAC-domain protein-like | ||||
STRING | AT5G22380.1 | 1e-175 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1445 | 28 | 93 | Representative plant | OGRP2278 | 11 | 36 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G22380.1 |
Entrez Gene | 832299 |
iHOP | AT5G22380 |
wikigenes | AT5G22380 |
Publications ? help Back to Top | |||
---|---|---|---|
|