PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01025075001
Common NameVIT_06s0004g03780
Organism
Vitis vinifera
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family WOX
Protein Properties Length: 133aa    MW: 15748 Da    PI: 10.4426
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01025075001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.43.9e-21766357
                       --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                       +R+++t+eql +Lee+++   r+p+a+++++++++l    +++ ++V++WFqN++a++++
  GSVIVT01025075001  7 SRWCPTPEQLMILEEMYRGgVRTPNASQIQQITAHLsfygKIEGKNVFYWFQNHKARDRQ 66
                       7*****************99*************************************996 PP
2Wus_type_Homeobox122.22.1e-39567264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       a++RW+PtpeQ++iLee+y+ G+rtPn+++iq+ita+L+ yGkie+kNVfyWFQN+kaR+rqk
  GSVIVT01025075001  5 ASSRWCPTPEQLMILEEMYRGGVRTPNASQIQQITAHLSFYGKIEGKNVFYWFQNHKARDRQK 67
                       689***********************************************************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.009267IPR001356Homeobox domain
SMARTSM003891.4E-4471IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.7E-8766IPR009057Homeodomain-like
SuperFamilySSF466891.15E-11766IPR009057Homeodomain-like
PfamPF000466.4E-19766IPR001356Homeobox domain
CDDcd000863.45E-4867No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MSPAASSRWC PTPEQLMILE EMYRGGVRTP NASQIQQITA HLSFYGKIEG KNVFYWFQNH  60
KARDRQKLRR KLSKQLQQQQ QFHQHHHQPL QQQNQRNQPL LHYLDPPVYS AFHQLFNYNT  120
SPFLPQVILI LI*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed in the L1 cells of the lateral regions of a flower primordium at early stage 1, in which the lateral sepals are expected to develop at a later stage. It then rapidly decreases at the late stage 1 and disappears at stage 2. At stage 3, it reappears in all four-sepal young primordia. Not detected at the central zone of the inflorescence meristem and the floral meristem. In stages 4 through 6, when four sepals develop to enclose the flower bud, it is localized at the lateral edges of the four sepals and forms an arch of the L1 cells at the margin of sepals. Expressed in the young primordia of petals and stamens. As the petals and stamens develop, it is limited at the margins of petals and stamens in a way similar to that of sepals. In the vegetative phase, it is expressed at the lateral regions of young leaf primordia, as well as in flowers and floral organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:14711878}.
UniprotTISSUE SPECIFICITY: Expressed in aerial parts of seedlings, inflorescences and flowers at low level. Expressed in a restricted number of L1 cells at the lateral regions of flower primordia. {ECO:0000269|PubMed:11751640}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:15169755}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4290350.0AM429035.2 Vitis vinifera contig VV78X068576.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002281707.11e-89PREDICTED: WUSCHEL-related homeobox 3
SwissprotQ9SIB42e-44WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBLD7SKP42e-92D7SKP4_VITVI; Uncharacterized protein
STRINGVIT_06s0004g03780.t013e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP55801121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.13e-40WOX family protein
Publications ? help Back to Top
  1. Chandler JW,Werr W
    Arabidopsis floral phytomer development: auxin response relative to biphasic modes of organ initiation.
    J. Exp. Bot., 2014. 65(12): p. 3097-110
    [PMID:24744428]
  2. Niu L, et al.
    LOOSE FLOWER, a WUSCHEL-like Homeobox gene, is required for lateral fusion of floral organs in Medicago truncatula.
    Plant J., 2015. 81(3): p. 480-92
    [PMID:25492397]
  3. Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL
    Active suppression of a leaf meristem orchestrates determinate leaf growth.
    Elife, 2017.
    [PMID:27710768]
  4. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]