PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01024206001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 228aa MW: 25091.9 Da PI: 10.1295 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 188.6 | 2.3e-58 | 30 | 167 | 3 | 153 |
DUF702 3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssa 94 s + sCqdCGnqakkdC h+RCRtCCk rgf+C+thvkstWvp+++rr+rqq+l a++ ++ + +++r ++s t+++ + GSVIVT01024206001 30 SRSLSCQDCGNQAKKDCLHMRCRTCCKGRGFQCQTHVKSTWVPVYRRRQRQQHLPATTVPQQL--L--QGHNPRP-------TSSGTTVAPT 110 56789***********************************************99997655432..2..2223332.......2222333333 PP DUF702 95 eskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153 + + +++++P+evss+a+fr+vrv+s+d++ +++aYqtav igGh+fkGiLyd+G+e GSVIVT01024206001 111 TDP--HKARNFPAEVSSPAMFRRVRVNSIDNAVDQYAYQTAVIIGGHIFKGILYDEGPE 167 333..46779***********************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 4.1E-58 | 33 | 167 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01623 | 3.3E-27 | 34 | 76 | IPR006510 | Zinc finger, lateral root primordium type 1 |
TIGRFAMs | TIGR01624 | 4.6E-24 | 119 | 166 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 228 aa Download sequence Send to blast |
MATVVVCWCL KKLAKPPSFV MMLMMRQGGS RSLSCQDCGN QAKKDCLHMR CRTCCKGRGF 60 QCQTHVKSTW VPVYRRRQRQ QHLPATTVPQ QLLQGHNPRP TSSGTTVAPT TDPHKARNFP 120 AEVSSPAMFR RVRVNSIDNA VDQYAYQTAV IIGGHIFKGI LYDEGPEIQF IGGGESLFPQ 180 LQQPTIVAST FTAAMELLHP SSSYPINSTS TTTAPVPGTH VIPHRRS* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In germinating seeds, first detected at about 48 h after imbibition. In young seedlings grown in continuous light, present in the root/shoot transition zone, in the apex, and in the apical region of the cotyledons. Later observed in lateral root primordia and in emerging lateral roots, particularly in the root tips, as well as in the shoot apex and in the new leaves, especially in the apical and lateral hydathodes. In adult plants, accumulates in lateral root tips, lateral root primordia, and axillary shoot primordia. In flowers, expressed in the style and stigmatic surface of the pistil and in the receptacle (base) of the flower throughout the development of the pistil until anthesis and later in the silique. Fades out after fertilization. {ECO:0000269|PubMed:11706176, ECO:0000269|PubMed:16740146}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young organs such as shoot apices and root tips. Present in roots, stems, flowers, leaves, hydathodes and siliques. {ECO:0000269|PubMed:10368174, ECO:0000269|PubMed:11706176}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Suppressor of the gibberellin (GA) signal transduction. {ECO:0000269|PubMed:10368174, ECO:0000269|PubMed:11706176, ECO:0000269|PubMed:16740146}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM460226 | 0.0 | AM460226.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X077132.15, clone ENTAV 115. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010647684.2 | 1e-136 | PREDICTED: protein SHORT INTERNODES | ||||
Swissprot | Q9XGX0 | 9e-50 | SHI_ARATH; Protein SHORT INTERNODES | ||||
TrEMBL | F6I1A1 | 1e-153 | F6I1A1_VITVI; Uncharacterized protein | ||||
STRING | VIT_03s0038g00310.t01 | 1e-154 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP1313 | 15 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66350.1 | 4e-52 | Lateral root primordium (LRP) protein-related |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01024206001 |
Publications ? help Back to Top | |||
---|---|---|---|
|