PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G66350.1 | ||||||||
Common Name | SHI | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 331aa MW: 35376.8 Da PI: 8.2647 | ||||||||
Description | Lateral root primordium (LRP) protein-related | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 227.4 | 2.7e-70 | 115 | 263 | 3 | 154 |
DUF702 3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkel 100 sg+ sCqdCGnq+kkdC+h+RCRtCCksrg+dC thvkstWvpaakrrerqqql++ ++ ++ + +kr+re +++++++ t+++s++++ l AT5G66350.1 115 SGGPSCQDCGNQSKKDCSHMRCRTCCKSRGLDCPTHVKSTWVPAAKRRERQQQLSTGQQ--PQQLGGSVPKRQRERIPARSTSMAYTRIPSNNTS-GL 209 68889***********************************************9998755..55779999*********************99866.99 PP DUF702 101 etsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154 e+ ++P+evss+avfrcvrvssvdd+eee+aY+tavsigGhvfkG+LydqG++e AT5G66350.1 210 EVGNFPPEVSSSAVFRCVRVSSVDDEEEEYAYKTAVSIGGHVFKGVLYDQGPAE 263 999************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 2.1E-64 | 117 | 262 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01623 | 1.9E-26 | 119 | 161 | IPR006510 | Zinc finger, lateral root primordium type 1 |
TIGRFAMs | TIGR01624 | 6.9E-26 | 214 | 261 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0009734 | Biological Process | auxin-activated signaling pathway | ||||
GO:0009851 | Biological Process | auxin biosynthetic process | ||||
GO:0009938 | Biological Process | negative regulation of gibberellic acid mediated signaling pathway | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000016 | anatomy | lateral root primordium | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0004709 | anatomy | axillary bud | ||||
PO:0005660 | anatomy | hydathode | ||||
PO:0006332 | anatomy | seed funicle | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0009073 | anatomy | stigma | ||||
PO:0009074 | anatomy | style | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007057 | developmental stage | seed germination stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 331 aa Download sequence Send to blast |
MAGFFSLGHG GGGNTPDNHR TNTNNPSSSG TESWLWCRNP NSNADGGEAG PSYKGTLELW 60 QHPNNQEIIF QQQQQQQQRL DLYTSAAGLG VGPSNRSLIE TSGGALMMMR SGSGSGGPSC 120 QDCGNQSKKD CSHMRCRTCC KSRGLDCPTH VKSTWVPAAK RRERQQQLST GQQPQQLGGS 180 VPKRQRERIP ARSTSMAYTR IPSNNTSGLE VGNFPPEVSS SAVFRCVRVS SVDDEEEEYA 240 YKTAVSIGGH VFKGVLYDQG PAERSSSGGG SQPLNLITAG PSASSSSPNV SCNNGVVGST 300 SDHYIDPASL NYPTPINTFM TGTHFFSNSR S |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 4929802 | 0.0 | ||||
Genevisible | 247093_at | 0.0 | ||||
Expression Atlas | AT5G66350 | - | ||||
AtGenExpress | AT5G66350 | - | ||||
ATTED-II | AT5G66350 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In germinating seeds, first detected at about 48 h after imbibition. In young seedlings grown in continuous light, present in the root/shoot transition zone, in the apex, and in the apical region of the cotyledons. Later observed in lateral root primordia and in emerging lateral roots, particularly in the root tips, as well as in the shoot apex and in the new leaves, especially in the apical and lateral hydathodes. In adult plants, accumulates in lateral root tips, lateral root primordia, and axillary shoot primordia. In flowers, expressed in the style and stigmatic surface of the pistil and in the receptacle (base) of the flower throughout the development of the pistil until anthesis and later in the silique. Fades out after fertilization. {ECO:0000269|PubMed:11706176, ECO:0000269|PubMed:16740146}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young organs such as shoot apices and root tips. Present in roots, stems, flowers, leaves, hydathodes and siliques. {ECO:0000269|PubMed:10368174, ECO:0000269|PubMed:11706176}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | A member of SHI gene family. Arabidopsis thaliana has ten members that encode proteins with a RING finger-like zinc finger motif. Despite being highly divergent in sequence, many of the SHI-related genes are partially redundant in function and synergistically promote gynoecium, stamen and leaf development in Arabidopsis. Shi mutant is dominant, has dwarf phenotype. Loss of function mutations have no observable phenotype. Putative zinc finger protein. Involved in the response to gibberellic acid. | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Suppressor of the gibberellin (GA) signal transduction. {ECO:0000269|PubMed:10368174, ECO:0000269|PubMed:11706176, ECO:0000269|PubMed:16740146}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G66350.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | gibberellin |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: High gibberellin (GA) levels associated with dwarfism, short hypocotyl, narrow leaves, reduced apical dominance, and late flowering, but more flowers. {ECO:0000269|PubMed:10368174, ECO:0000269|PubMed:11706176, ECO:0000269|PubMed:16740146}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G66350 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF152555 | 0.0 | AF152555.1 Arabidopsis thaliana putative zinc finger protein SHI (SHI) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_201436.1 | 0.0 | Lateral root primordium (LRP) protein-like protein | ||||
Swissprot | Q9XGX0 | 0.0 | SHI_ARATH; Protein SHORT INTERNODES | ||||
TrEMBL | A0A178UL82 | 0.0 | A0A178UL82_ARATH; SHI | ||||
STRING | AT5G66350.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3419 | 28 | 64 | Representative plant | OGRP1872 | 11 | 40 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G66350.1 |
Entrez Gene | 836767 |
iHOP | AT5G66350 |
wikigenes | AT5G66350 |