PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01018809001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 275aa MW: 32148.3 Da PI: 9.4087 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 180.5 | 4.4e-56 | 5 | 134 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 +ppGfrFhPtdeelv +yLkkkv+++k++l +vi+++d+y++ePwdL++ ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+d GSVIVT01018809001 5 VPPGFRFHPTDEELVGYYLKKKVASQKIDL-DVIRDIDLYRIEPWDLQErcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRD 95 69****************************.9***************953432233667********************************* PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 k+v++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle GSVIVT01018809001 96 KAVYD-KTKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 134 *****.999*****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.88E-60 | 3 | 154 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 59.153 | 5 | 154 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.1E-29 | 6 | 133 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0048759 | Biological Process | xylem vessel member cell differentiation | ||||
GO:1901348 | Biological Process | positive regulation of secondary cell wall biogenesis | ||||
GO:1990110 | Biological Process | callus formation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 275 aa Download sequence Send to blast |
MESCVPPGFR FHPTDEELVG YYLKKKVASQ KIDLDVIRDI DLYRIEPWDL QERCRIGYEE 60 QNEWYFFSHK DKKYPTGTRT NRATMAGFWK ATGRDKAVYD KTKLIGMRKT LVFYKGRAPN 120 GQKTDWIMHE YRLESEENGP PQAKGWVVCR AFKKRTTSQS KSIEGWDTSY FYDEPSGVST 180 VMDPIDYISR QPQNYLGQNF LCKQEIEADN LNFMHATEHF VQLPQLESPS LPLMKRPSST 240 YKKHNPIYGY VRNIGSRNDI SSQNINSNNL RRPR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-51 | 5 | 159 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-51 | 5 | 159 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-51 | 5 | 159 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-51 | 5 | 159 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-51 | 5 | 159 | 20 | 173 | NAC domain-containing protein 19 |
3swm_B | 3e-51 | 5 | 159 | 20 | 173 | NAC domain-containing protein 19 |
3swm_C | 3e-51 | 5 | 159 | 20 | 173 | NAC domain-containing protein 19 |
3swm_D | 3e-51 | 5 | 159 | 20 | 173 | NAC domain-containing protein 19 |
3swp_A | 3e-51 | 5 | 159 | 20 | 173 | NAC domain-containing protein 19 |
3swp_B | 3e-51 | 5 | 159 | 20 | 173 | NAC domain-containing protein 19 |
3swp_C | 3e-51 | 5 | 159 | 20 | 173 | NAC domain-containing protein 19 |
3swp_D | 3e-51 | 5 | 159 | 20 | 173 | NAC domain-containing protein 19 |
4dul_A | 2e-51 | 5 | 159 | 17 | 170 | NAC domain-containing protein 19 |
4dul_B | 2e-51 | 5 | 159 | 17 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in root metaxylem pole and in shoot pre-procambium and procambium (PubMed:18445131). Present in root developing xylems (PubMed:16103214). Specifically expressed in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00266 | DAP | Transfer from AT2G18060 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM473037 | 1e-159 | AM473037.2 Vitis vinifera contig VV78X060572.10, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010649056.1 | 0.0 | PREDICTED: NAC domain-containing protein 37 isoform X2 | ||||
Swissprot | Q9SL41 | 1e-149 | NAC37_ARATH; NAC domain-containing protein 37 | ||||
TrEMBL | F6GWP2 | 0.0 | F6GWP2_VITVI; Uncharacterized protein | ||||
STRING | VIT_04s0023g03110.t01 | 0.0 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G18060.1 | 1e-139 | vascular related NAC-domain protein 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01018809001 |
Publications ? help Back to Top | |||
---|---|---|---|
|