PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G18060.1 | ||||||||
Common Name | ANAC037, NAC037, T27K22.7, VND1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 365aa MW: 42476.7 Da PI: 5.2318 | ||||||||
Description | vascular related NAC-domain protein 1 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 177.3 | 4e-55 | 9 | 138 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 +ppGfrFhPtdeelv +yL+kk++++k++l +vi+++d+y++ePwdL++ ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v++ AT2G18060.1 9 VPPGFRFHPTDEELVGYYLRKKIASQKIDL-DVIRDIDLYRIEPWDLQEqcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYD- 104 69****************************.9***************953432233667**************************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrle 129 k++l+g++ktLvfykgrap+g+k+dW+mheyrle AT2G18060.1 105 KTKLIGMRKTLVFYKGRAPNGKKSDWIMHEYRLE 138 999*****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.7E-60 | 3 | 158 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 59.279 | 9 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 9.7E-29 | 10 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0048759 | Biological Process | xylem vessel member cell differentiation | ||||
GO:0071555 | Biological Process | cell wall organization | ||||
GO:1901348 | Biological Process | positive regulation of secondary cell wall biogenesis | ||||
GO:1990110 | Biological Process | callus formation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0005515 | Molecular Function | protein binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0003011 | anatomy | root vascular system | ||||
PO:0009005 | anatomy | root | ||||
PO:0009046 | anatomy | flower | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0025275 | anatomy | procambium | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 365 aa Download sequence Send to blast |
MEPMESCSVP PGFRFHPTDE ELVGYYLRKK IASQKIDLDV IRDIDLYRIE PWDLQEQCRI 60 GYEEQNEWYF FSHKDKKYPT GTRTNRATMA GFWKATGRDK AVYDKTKLIG MRKTLVFYKG 120 RAPNGKKSDW IMHEYRLESD ENAPPQEEGW VVCRAFKKRA TGQAKNTETW SSSYFYDEVA 180 PNGVNSVMDP IDYISKQQHN IFGKGLMCKQ ELEGMVDGIN YIQSNQFIQL PQLQSPSLPL 240 MKRPSSSMSI TSMDNNYNYK LPLADEESFE SFIRGEDRRK KKKQVMMTGN WRELDKFVAS 300 QLMSQEDNGT SSFAGHHIVN EDKNNNDVEM DSSMFLSERE EENRFVSEFL STNSDYDIGI 360 CVFDN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 7e-51 | 2 | 163 | 10 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 7e-51 | 2 | 163 | 10 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 7e-51 | 2 | 163 | 10 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 7e-51 | 2 | 163 | 10 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 7e-51 | 2 | 163 | 13 | 173 | NAC domain-containing protein 19 |
3swm_B | 7e-51 | 2 | 163 | 13 | 173 | NAC domain-containing protein 19 |
3swm_C | 7e-51 | 2 | 163 | 13 | 173 | NAC domain-containing protein 19 |
3swm_D | 7e-51 | 2 | 163 | 13 | 173 | NAC domain-containing protein 19 |
3swp_A | 7e-51 | 2 | 163 | 13 | 173 | NAC domain-containing protein 19 |
3swp_B | 7e-51 | 2 | 163 | 13 | 173 | NAC domain-containing protein 19 |
3swp_C | 7e-51 | 2 | 163 | 13 | 173 | NAC domain-containing protein 19 |
3swp_D | 7e-51 | 2 | 163 | 13 | 173 | NAC domain-containing protein 19 |
4dul_A | 7e-51 | 2 | 163 | 10 | 170 | NAC domain-containing protein 19 |
4dul_B | 7e-51 | 2 | 163 | 10 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 276 | 282 | DRRKKKK |
2 | 277 | 282 | RRKKKK |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 18398607 | 0.0 | ||||
Genevisible | 265813_at | 0.0 | ||||
Expression Atlas | AT2G18060 | - | ||||
AtGenExpress | AT2G18060 | - | ||||
ATTED-II | AT2G18060 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in root metaxylem pole and in shoot pre-procambium and procambium (PubMed:18445131). Present in root developing xylems (PubMed:16103214). Specifically expressed in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a NAC-domain transcription factor. Expressed in the vascular tissue. | |||||
UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00266 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G18060.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT5G13180 | |||||
IntAct | Search Q9SL41 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G18060 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC006201 | 0.0 | AC006201.4 Arabidopsis thaliana chromosome 2 clone T27K22 map c245, complete sequence. | |||
GenBank | CP002685 | 0.0 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001318244.1 | 0.0 | vascular related NAC-domain protein 1 | ||||
Refseq | NP_179397.1 | 0.0 | vascular related NAC-domain protein 1 | ||||
Swissprot | Q9SL41 | 0.0 | NAC37_ARATH; NAC domain-containing protein 37 | ||||
TrEMBL | A0A178VM15 | 0.0 | A0A178VM15_ARATH; VND1 | ||||
STRING | AT2G18060.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3686 | 26 | 61 | Representative plant | OGRP17 | 15 | 800 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G18060.1 |
Entrez Gene | 816318 |
iHOP | AT2G18060 |
wikigenes | AT2G18060 |