PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01016332001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 166aa MW: 18224.8 Da PI: 8.1073 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 133.7 | 7e-42 | 41 | 140 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 +CaaCkvlrr+C++ C lapyfp +++ kf ++hk+FGasn++k l++lpe++r da+ss+vyeA++r++dPvyG++g i+klq+ql+ l+a GSVIVT01016332001 41 PCAACKVLRRRCTDTCSLAPYFPPSEQLKFVIAHKVFGASNIVKALQELPESKRADAVSSMVYEANVRIHDPVYGCAGAISKLQKQLNDLQA 132 7******************************************************************************************* PP DUF260 93 elallkee 100 ela++++e GSVIVT01016332001 133 ELAVTQAE 140 ****9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 25.086 | 40 | 141 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.6E-41 | 41 | 138 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MEYTNKTRRS LRVSTPFSFS SSSYSPSLMP SPSLPTVVQG PCAACKVLRR RCTDTCSLAP 60 YFPPSEQLKF VIAHKVFGAS NIVKALQELP ESKRADAVSS MVYEANVRIH DPVYGCAGAI 120 SKLQKQLNDL QAELAVTQAE LLIMQCQQQQ QNDIASFYDR DLGSD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 6e-41 | 41 | 148 | 11 | 118 | LOB family transfactor Ramosa2.1 |
5ly0_B | 6e-41 | 41 | 148 | 11 | 118 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM429591 | 1e-141 | AM429591.2 Vitis vinifera contig VV78X052699.4, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002275182.2 | 1e-120 | PREDICTED: LOB domain-containing protein 1 | ||||
Swissprot | Q9LQR0 | 8e-54 | LBD1_ARATH; LOB domain-containing protein 1 | ||||
Swissprot | Q9SK08 | 3e-53 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
TrEMBL | A0A438CGW8 | 1e-118 | A0A438CGW8_VITVI; LOB domain-containing protein 1 | ||||
STRING | VIT_13s0019g03760.t01 | 1e-97 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28500.1 | 5e-54 | LOB domain-containing protein 11 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01016332001 |