PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01015101001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 208aa MW: 24183.9 Da PI: 10.6662 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.3 | 2.3e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W++ Ed++l ++++ +G g Wk ++ + g++R++k+c++rw++yl GSVIVT01015101001 14 RGTWSALEDKILCNYIEIYGEGKWKEVPPRAGLKRCGKSCRLRWLNYL 61 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.6 | 2.4e-17 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ +++E+el+++++k+lG++ W++Ia +++ gRt++++k++w++ GSVIVT01015101001 67 RGNISEDEEELIIKLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111 7899******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.047 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.69E-28 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.5E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.7E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-21 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.81E-8 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 26.676 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 6.9E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-25 | 69 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.00E-11 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 208 aa Download sequence Send to blast |
MGRKPYCVKE GLNRGTWSAL EDKILCNYIE IYGEGKWKEV PPRAGLKRCG KSCRLRWLNY 60 LRPDIKRGNI SEDEEELIIK LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLKKKLLPQH 120 SPHKQRTKFK SNTPLPRNSS SHHTVIRTKA VRCMQLDFSH AFPTRSQPGT LCPPDFDMGQ 180 RRVERSWKGR WNPNFLIFYA CATHVSN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-26 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Highly expressed from the very early stages of embryogenesis to the globular stage, decreases rapidly from the late heart-torpedo stage and did not persist after the completion of embryogenesis. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed at a high level in immature siliques and at a lower level in flowers. Undetected in young seedlings, roots, leaves and inflorescence stems. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269|PubMed:15361138}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM440323 | 1e-154 | AM440323.2 Vitis vinifera contig VV78X195889.3, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002278229.2 | 1e-132 | PREDICTED: transcription factor TT2 | ||||
Swissprot | Q9FJA2 | 2e-59 | TT2_ARATH; Transcription factor TT2 | ||||
TrEMBL | F6HGP5 | 1e-130 | F6HGP5_VITVI; Uncharacterized protein | ||||
STRING | VIT_11s0016g01310.t01 | 1e-131 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G35550.1 | 2e-51 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01015101001 |