Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | GRAS | 46 | 9e-15 | 162 | 216 | 1 | 55 |
GRAS 1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar 55
lv++L++cAeav++++l+la+al++++ la +++ +m+++a+yf+e+La+r++r
GSVIVT01011710001 162 LVHTLMACAEAVQQENLKLAEALVKQIGFLAVSQAGAMRKVATYFAEGLARRIYR 216
689**************************************************98 PP
|
2 | GRAS | 191.1 | 7.2e-59 | 224 | 377 | 116 | 273 |
GRAS 116 DfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlv 207
D +++qG+QWpaL+qaLa Rp+gpps+R+Tg+g+p++++++ l+e+g++La++Ae+++v+fe++ +va++l+dl+ ++L+++ gE++aVn+v
GSVIVT01011710001 224 DSSMKQGMQWPALMQALALRPGGPPSFRLTGIGPPSTDNTDHLHEVGWKLAQLAETIHVEFEYRGFVANSLADLDASMLELRDGESVAVNSV 315
7899**************************************************************************************** PP
GRAS 208 lqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
++lh+ll++++ +e vL++vk+++P++v++veqea+hn++ Fl+rf+e+l+yys+lfdsle
GSVIVT01011710001 316 FELHSLLARPGGIER----VLSAVKDMKPDIVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG 377
*******99999999....*********************************************74 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0009723 | Biological Process | response to ethylene |
GO:0009737 | Biological Process | response to abscisic acid |
GO:0009863 | Biological Process | salicylic acid mediated signaling pathway |
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway |
GO:0009938 | Biological Process | negative regulation of gibberellic acid mediated signaling pathway |
GO:0010187 | Biological Process | negative regulation of seed germination |
GO:0010218 | Biological Process | response to far red light |
GO:0042176 | Biological Process | regulation of protein catabolic process |
GO:0042538 | Biological Process | hyperosmotic salinity response |
GO:2000033 | Biological Process | regulation of seed dormancy process |
GO:2000377 | Biological Process | regulation of reactive oxygen species metabolic process |
GO:0005634 | Cellular Component | nucleus |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | EF141295 | 0.0 | EF141295.1 Vitis sp. Nie 415 GAI-like protein 1 (GAI1) gene, partial cds. |
GenBank | HM223431 | 0.0 | HM223431.1 Parthenocissus henryana voucher Nie & Meng 405 (KUN) GAI-like protein 1 (GAI1) gene, partial cds. |
GenBank | HQ834311 | 0.0 | HQ834311.1 Vitis vinifera GAI1 mRNA, complete cds. |
GenBank | KT344726 | 0.0 | KT344726.1 Vitis sp. Wen 10025 GAI-like protein 1 (GAI1) gene, partial cds. |
GenBank | KT344729 | 0.0 | KT344729.1 Vitis amurensis voucher Wen 8583 (US) GAI-like protein 1 (GAI1) gene, partial cds. |
GenBank | KT344731 | 0.0 | KT344731.1 Vitis bellula voucher Wen 11271 (US) GAI-like protein 1 (GAI1) gene, partial cds. |
GenBank | KT344736 | 0.0 | KT344736.1 Vitis cinerea var. helleri voucher Wen 9709 (US) GAI-like protein 1 (GAI1) gene, partial cds. |
GenBank | KT344737 | 0.0 | KT344737.1 Vitis davidii voucher Wen 9060 (US) GAI-like protein 1 (GAI1) gene, partial cds. |
GenBank | KT344741 | 0.0 | KT344741.1 Vitis heyneana voucher Wen 10815 (US) GAI-like protein 1 (GAI1) gene, partial cds. |
GenBank | KT344742 | 0.0 | KT344742.1 Vitis heyneana voucher Wen 10647 (US) GAI-like protein 1 (GAI1) gene, partial cds. |
GenBank | KT344750 | 0.0 | KT344750.1 Vitis menghaiensis voucher Nie & Meng 405 (US) GAI-like protein 1 (GAI1) gene, partial cds. |
GenBank | KT344752 | 0.0 | KT344752.1 Vitis mengziensis voucher Nie & Meng 415 (KUN, US) GAI-like protein 1 (GAI1) gene, partial cds. |
GenBank | KT344754 | 0.0 | KT344754.1 Vitis piasezkii voucher Wen 9036 (US) GAI-like protein 1 (GAI1) gene, partial cds. |
GenBank | KT344757 | 0.0 | KT344757.1 Vitis pseudoreticulata voucher Wen 11619 (US) GAI-like protein 1 (GAI1) gene, partial cds. |
GenBank | KT344765 | 0.0 | KT344765.1 Vitis sp. Zhang 347 GAI-like protein 1 (GAI1) gene, partial cds. |
GenBank | KT344766 | 0.0 | KT344766.1 Vitis tiliifolia voucher Wen 8713 (US) GAI-like protein 1 (GAI1) gene, partial cds. |