PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01009424001 | ||||||||
Common Name | LOC100243698, VIT_18s0001g09850 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 262aa MW: 28799.8 Da PI: 9.3613 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 62.9 | 6.5e-20 | 23 | 68 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde l ++v+++G+++W++I++ ++ gR++k+c++rw + GSVIVT01009424001 23 KGPWSPEEDEALQRLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 68 79******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 52.7 | 9.8e-17 | 77 | 119 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T+eEd +++a++++G++ W+tIar + gRt++ +k++w++ GSVIVT01009424001 77 AFTPEEDATIIRAHARFGNK-WATIARLLV-GRTDNAIKNHWNST 119 79******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.642 | 18 | 73 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.12E-32 | 20 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.1E-18 | 22 | 71 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-19 | 23 | 68 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.1E-27 | 24 | 76 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.02E-17 | 25 | 67 | No hit | No description |
SMART | SM00717 | 5.1E-14 | 74 | 122 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.886 | 75 | 124 | IPR017930 | Myb domain |
Pfam | PF00249 | 2.3E-14 | 77 | 119 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.43E-11 | 77 | 120 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.5E-23 | 77 | 123 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 262 aa Download sequence Send to blast |
MLSPHTKASQ SMASSKKDLD RIKGPWSPEE DEALQRLVQK HGPRNWSLIS KSIPGRSGKS 60 CRLRWCNQLS PQVEHRAFTP EEDATIIRAH ARFGNKWATI ARLLVGRTDN AIKNHWNSTL 120 KRKCSPSSPS GSEFSDSSAP GMASSLVYRP VPRTGPIVLP TQKIEAASST NDPPTSLSLS 180 LPGSDSCEVS NHLSGSDHNC ELGLGMSEKP FFTPEFLAVM QEMIRKEVRN YMSGMEQNGL 240 CLQTEAIWNA VMKRIGIGKI E* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-41 | 22 | 124 | 3 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 8e-41 | 22 | 124 | 57 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 8e-41 | 22 | 124 | 57 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 1e-41 | 22 | 124 | 3 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 1e-41 | 22 | 124 | 3 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.2288 | 0.0 | bud| cell culture| flower| fruit| inflorescence| leaf| root |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00476 | DAP | Transfer from AT4G37260 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FQ395161 | 0.0 | FQ395161.1 Vitis vinifera clone SS0AFA17YH05. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002285015.1 | 1e-174 | PREDICTED: transcription factor MYB44 | ||||
Swissprot | O23160 | 4e-84 | MYB73_ARATH; Transcription factor MYB73 | ||||
TrEMBL | A0A438DYA7 | 1e-172 | A0A438DYA7_VITVI; Transcription factor MYB44 | ||||
TrEMBL | F6GZY0 | 1e-172 | F6GZY0_VITVI; Uncharacterized protein | ||||
STRING | VIT_18s0001g09850.t01 | 1e-173 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37260.1 | 3e-70 | myb domain protein 73 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01009424001 |
Entrez Gene | 100243698 |
Publications ? help Back to Top | |||
---|---|---|---|
|