PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT4G37260.1

Common Name

ATMYB73, C7A10.100, MYB73

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 320aa MW: 34848.7 Da PI: 6.3762

Description

myb domain protein 73

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT4G37260.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	62.3	1e-19	13	58	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd+ll ++v+++G+++W++I++ ++ gR++k+c++rw + AT4G37260.1 13 KGPWSPEEDDLLQRLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 58 79****************************.*********985 PP
2	Myb_DNA-binding	54.1	3.7e-17	67	109	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++eEde +++a++++G++ W+tI+r ++ gRt++ +k++w++ AT4G37260.1 67 AFSQEEDETIIRAHARFGNK-WATISRLLN-GRTDNAIKNHWNST 109 79****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	26.985	8	63	IPR017930	Myb domain
SuperFamily	SSF46689	1.62E-31	10	106	IPR009057	Homeodomain-like
SMART	SM00717	9.4E-18	12	61	IPR001005	SANT/Myb domain
Pfam	PF00249	9.2E-20	13	58	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.7E-26	14	66	IPR009057	Homeodomain-like
CDD	cd00167	5.98E-17	15	57	No hit	No description
SMART	SM00717	2.8E-14	64	112	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	20.293	65	114	IPR017930	Myb domain
Pfam	PF00249	1.4E-14	67	109	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.3E-22	67	113	IPR009057	Homeodomain-like
CDD	cd00167	1.63E-11	67	110	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009723	Biological Process	response to ethylene
GO:0009737	Biological Process	response to abscisic acid
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010200	Biological Process	response to chitin
GO:0030154	Biological Process	cell differentiation
GO:0046686	Biological Process	response to cadmium ion
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000084	anatomy	plant sperm cell
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020003	anatomy	plant ovule
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025195	anatomy	pollen tube cell
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 320 aa Download sequence Send to blast
MSNPTRKNME RIKGPWSPEE DDLLQRLVQK HGPRNWSLIS KSIPGRSGKS CRLRWCNQLS 60 PEVEHRAFSQ EEDETIIRAH ARFGNKWATI SRLLNGRTDN AIKNHWNSTL KRKCSVEGQS 120 CDFGGNGGYD GNLGEEQPLK RTASGGGGVS TGLYMSPGSP SGSDVSEQSS GGAHVFKPTV 180 RSEVTASSSG EDPPTYLSLS LPWTDETVRV NEPVQLNQNT VMDGGYTAEL FPVRKEEQVE 240 VEEEEAKGIS GGFGGEFMTV VQEMIRTEVR SYMADLQRGN VGGSSSGGGG GGSCMPQSVN 300 SRRVGFREFI VNQIGIGKME

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	3e-40	10	113	1	104	MYB PROTO-ONCOGENE PROTEIN
1h88_C	4e-40	8	114	53	159	MYB PROTO-ONCOGENE PROTEIN
1h89_C	4e-40	8	114	53	159	MYB PROTO-ONCOGENE PROTEIN
1mse_C	4e-40	12	113	3	104	C-Myb DNA-Binding Domain
1msf_C	4e-40	12	113	3	104	C-Myb DNA-Binding Domain
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.56989	0.0	flower\| inflorescence\| leaf\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	246253_at	0.0
Expression Atlas	AT4G37260	-
AtGenExpress	AT4G37260	-
ATTED-II	AT4G37260	-

Functional Description ? help Back to Top
Source	Description
TAIR	Member of the R2R3 factor gene family.
UniProt	Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269\|PubMed:23809151, ECO:0000269\|PubMed:24894996}.

Function -- GeneRIF ? help Back to Top
AtMyb73 expression was upregulated by salt stress but not by other stresses. Accumulation of salt overly sensitive (SOS) transcripts, SOS1 and SOS3, was higher in atmyb73 ko and atmyb73 eko plants than in wild type plants receiving 300mM NaCl treatment. [PMID: 23809151]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00476	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT4G37260.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress. {ECO:0000269\|PubMed:23809151}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT4G37260

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AL161591	0.0	AL161591.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 87.
GenBank	AY063912	0.0	AY063912.1 Arabidopsis thaliana putative myb-related protein (At4g37260) mRNA, complete cds.
GenBank	AY091267	0.0	AY091267.1 Arabidopsis thaliana putative myb-related protein (At4g37260) mRNA, complete cds.
GenBank	AY519613	0.0	AY519613.1 Arabidopsis thaliana MYB transcription factor (At4g37260) mRNA, complete cds.
GenBank	CP002687	0.0	CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBank	Z99707	0.0	Z99707.1 Arabidopsis thaliana DNA chromosome 4, ESSA I AP2 contig fragment No. 1.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_195443.1	0.0	myb domain protein 73
Swissprot	O23160	0.0	MYB73_ARATH; Transcription factor MYB73
TrEMBL	A0A178V4E7	0.0	A0A178V4E7_ARATH; MYB73
STRING	AT4G37260.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM677	28	135
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT4G37260.1
Entrez Gene	829880
iHOP	AT4G37260
wikigenes	AT4G37260

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Oono Y, et al. Monitoring expression profiles of Arabidopsis gene expression during rehydration process after dehydration using ca 7000 full-length cDNA microarray. Plant J., 2003. 34(6): p. 868-87 [PMID:12795706] Ko JH,Han KH,Park S,Yang J Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling. Plant Physiol., 2004. 135(2): p. 1069-83 [PMID:15194820] Kasukabe Y, et al. Overexpression of spermidine synthase enhances tolerance to multiple environmental stresses and up-regulates the expression of various stress-regulated genes in transgenic Arabidopsis thaliana. Plant Cell Physiol., 2004. 45(6): p. 712-22 [PMID:15215506] Guan Y,Nothnagel EA Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures. Plant Physiol., 2004. 135(3): p. 1346-66 [PMID:15235117] Lee D,Polisensky DH,Braam J Genome-wide identification of touch- and darkness-regulated Arabidopsis genes: a focus on calmodulin-like and XTH genes. New Phytol., 2005. 165(2): p. 429-44 [PMID:15720654] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Ma S,Bohnert HJ Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression. Genome Biol., 2007. 8(4): p. R49 [PMID:17408486] Libault M,Wan J,Czechowski T,Udvardi M,Stacey G Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11 [PMID:17722694] Peng M,Bi YM,Zhu T,Rothstein SJ Genome-wide analysis of Arabidopsis responsive transcriptome to nitrogen limitation and its regulation by the ubiquitin ligase gene NLA. Plant Mol. Biol., 2007. 65(6): p. 775-97 [PMID:17885809] Ferreira FJ,Guo C,Coleman JR Reduction of plastid-localized carbonic anhydrase activity results in reduced Arabidopsis seedling survivorship. Plant Physiol., 2008. 147(2): p. 585-94 [PMID:18434607] Wang Y, et al. Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] Skinner DJ,Gasser CS Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants. BMC Plant Biol., 2009. 9: p. 29 [PMID:19291320] Gaudinier A, et al. Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] Causier B,Ashworth M,Guo W,Davies B The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] Kim JH, et al. Loss of the R2R3 MYB, AtMyb73, causes hyper-induction of the SOS1 and SOS3 genes in response to high salinity in Arabidopsis. J. Plant Physiol., 2013. 170(16): p. 1461-5 [PMID:23809151] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhao Y, et al. The ABA receptor PYL8 promotes lateral root growth by enhancing MYB77-dependent transcription of auxin-responsive genes. Sci Signal, 2014. 7(328): p. ra53 [PMID:24894996] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]