Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 62.3 | 1e-19 | 13 | 58 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+g+W++eEd+ll ++v+++G+++W++I++ ++ gR++k+c++rw +
AT4G37260.1 13 KGPWSPEEDDLLQRLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 58
79******************************.***********985 PP
|
2 | Myb_DNA-binding | 54.1 | 3.7e-17 | 67 | 109 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
++++eEde +++a++++G++ W+tI+r ++ gRt++ +k++w++
AT4G37260.1 67 AFSQEEDETIIRAHARFGNK-WATISRLLN-GRTDNAIKNHWNST 109
79******************.*********.***********986 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] - Oono Y, et al.
Monitoring expression profiles of Arabidopsis gene expression during rehydration process after dehydration using ca 7000 full-length cDNA microarray. Plant J., 2003. 34(6): p. 868-87 [PMID:12795706] - Ko JH,Han KH,Park S,Yang J
Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling. Plant Physiol., 2004. 135(2): p. 1069-83 [PMID:15194820] - Kasukabe Y, et al.
Overexpression of spermidine synthase enhances tolerance to multiple environmental stresses and up-regulates the expression of various stress-regulated genes in transgenic Arabidopsis thaliana. Plant Cell Physiol., 2004. 45(6): p. 712-22 [PMID:15215506] - Guan Y,Nothnagel EA
Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures. Plant Physiol., 2004. 135(3): p. 1346-66 [PMID:15235117] - Lee D,Polisensky DH,Braam J
Genome-wide identification of touch- and darkness-regulated Arabidopsis genes: a focus on calmodulin-like and XTH genes. New Phytol., 2005. 165(2): p. 429-44 [PMID:15720654] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] - Ma S,Bohnert HJ
Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression. Genome Biol., 2007. 8(4): p. R49 [PMID:17408486] - Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11 [PMID:17722694] - Peng M,Bi YM,Zhu T,Rothstein SJ
Genome-wide analysis of Arabidopsis responsive transcriptome to nitrogen limitation and its regulation by the ubiquitin ligase gene NLA. Plant Mol. Biol., 2007. 65(6): p. 775-97 [PMID:17885809] - Ferreira FJ,Guo C,Coleman JR
Reduction of plastid-localized carbonic anhydrase activity results in reduced Arabidopsis seedling survivorship. Plant Physiol., 2008. 147(2): p. 585-94 [PMID:18434607] - Wang Y, et al.
Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] - Skinner DJ,Gasser CS
Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants. BMC Plant Biol., 2009. 9: p. 29 [PMID:19291320] - Gaudinier A, et al.
Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] - Causier B,Ashworth M,Guo W,Davies B
The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] - Kim JH, et al.
Loss of the R2R3 MYB, AtMyb73, causes hyper-induction of the SOS1 and SOS3 genes in response to high salinity in Arabidopsis. J. Plant Physiol., 2013. 170(16): p. 1461-5 [PMID:23809151] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Zhao Y, et al.
The ABA receptor PYL8 promotes lateral root growth by enhancing MYB77-dependent transcription of auxin-responsive genes. Sci Signal, 2014. 7(328): p. ra53 [PMID:24894996] - Kranz HD, et al.
Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]
|