PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01008601001 | ||||||||
Common Name | LOC100252516, VIT_17s0000g00770 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 210aa MW: 23960.8 Da PI: 8.0627 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 152.4 | 2.1e-47 | 14 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 lp GfrF+Ptdeelv +yLk kv +++l++ ++i+e+++ k++PwdLp e+e yfFs+++ ky+ g+r+nrat+sgyWka+g+dk++ GSVIVT01008601001 14 LPLGFRFQPTDEELVFQYLKCKVFSRPLPA-SIIPEINVSKYDPWDLPGD---LEQEKYFFSNKEAKYQIGNRSNRATSSGYWKASGTDKQI 101 699***************************.89***************54...46799********************************** PP NAM 93 lsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 +s+ +++lvg+kktLvfy+g+ p ++tdWvmheyrl GSVIVT01008601001 102 TSSrNSQLVGMKKTLVFYRGKPPYDSRTDWVMHEYRL 138 *9868888***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.7E-53 | 10 | 168 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 53.877 | 14 | 168 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.5E-26 | 15 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 210 aa Download sequence Send to blast |
MEKFNFVRDG VIRLPLGFRF QPTDEELVFQ YLKCKVFSRP LPASIIPEIN VSKYDPWDLP 60 GDLEQEKYFF SNKEAKYQIG NRSNRATSSG YWKASGTDKQ ITSSRNSQLV GMKKTLVFYR 120 GKPPYDSRTD WVMHEYRLLI AGAPQTKNTP SSSSIQMEDW VLCRVFLKRR TGAEHHEATE 180 SCSSGITEIS SSESDHEESS STAGYNFFH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-44 | 12 | 169 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-44 | 12 | 169 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-44 | 12 | 169 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-44 | 12 | 169 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
4dul_A | 1e-44 | 12 | 169 | 15 | 166 | NAC domain-containing protein 19 |
4dul_B | 1e-44 | 12 | 169 | 15 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM489170 | 1e-140 | AM489170.2 Vitis vinifera contig VV78X027678.5, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010663782.1 | 1e-157 | PREDICTED: NAC domain-containing protein 83 | ||||
Swissprot | Q9FY93 | 7e-77 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | D7SH38 | 1e-156 | D7SH38_VITVI; Uncharacterized protein | ||||
STRING | VIT_17s0000g00770.t01 | 1e-157 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 2e-78 | NAC domain containing protein 83 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01008601001 |
Entrez Gene | 100252516 |
Publications ? help Back to Top | |||
---|---|---|---|
|