PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01003547001

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

LBD

Protein Properties

Length: 142aa MW: 15563.8 Da PI: 8.3323

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01003547001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	120.5	9.6e-38	7	88	1	82
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilk 82 +CaaCk++rrkC+++C++apyfp +qp+kfanvhk+FGasnv kll++++ +reda++sl+yeAear++dPvyG+v+ i+ GSVIVT01003547001 7 PCAACKLQRRKCTQECIYAPYFPPDQPHKFANVHKVFGASNVAKLLNEINVAHREDAVNSLAYEAEARLHDPVYGCVNSITL 88 7****************************************************************************99875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	21.988	6	107	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	8.6E-38	7	89	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 142 aa Download sequence Send to blast
MSSSNSPCAA CKLQRRKCTQ ECIYAPYFPP DQPHKFANVH KVFGASNVAK LLNEINVAHR 60 EDAVNSLAYE AEARLHDPVY GCVNSITLTS SKSITISFSP SCCFRPKHSN AAMLSCTGFW 120 VIQNSTCDLR ILKVTLIHAD N*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	2e-40	3	92	7	96	LOB family transfactor Ramosa2.1
5ly0_B	2e-40	3	92	7	96	LOB family transfactor Ramosa2.1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Vvi.29474	3e-93	cell culture

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in trichomes, at the base of many lateral organs, including branching points of the inflorescence and floral organs and in the distal part of the pistil at stages when style and stigma start to develop. Also detected in pedicels and at the base of petals and sepals. {ECO:0000269\|PubMed:15821980}.

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269\|PubMed:12787254, ECO:0000269\|PubMed:15821980}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM484635	1e-136	AM484635.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X152740.2, clone ENTAV 115.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002263136.3	2e-57	PREDICTED: LOB domain-containing protein 36
Swissprot	Q9FKZ3	3e-44	LBD36_ARATH; LOB domain-containing protein 36
TrEMBL	A0A438FB10	5e-56	A0A438FB10_VITVI; LOB domain-containing protein 36
TrEMBL	A0A438KQT8	4e-56	A0A438KQT8_VITVI; LOB domain-containing protein 36
TrEMBL	F6H7Q9	4e-56	F6H7Q9_VITVI; Uncharacterized protein
STRING	VIT_07s0197g00030.t01	6e-57	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP60	16	318

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G66870.1	2e-45	ASYMMETRIC LEAVES 2-like 1

Link Out ? help Back to Top
Phytozome	GSVIVT01003547001

Publications ? help Back to Top
Kim M,Kim MJ,Pandey S,Kim J Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development. Plant Cell Physiol., 2016. 57(11): p. 2291-2299 [PMID:27519310] Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana. Plant Mol. Biol., 2016. 92(6): p. 661-674 [PMID:27605094]