PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01003547001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 142aa MW: 15563.8 Da PI: 8.3323 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 120.5 | 9.6e-38 | 7 | 88 | 1 | 82 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilk 82 +CaaCk++rrkC+++C++apyfp +qp+kfanvhk+FGasnv kll++++ +reda++sl+yeAear++dPvyG+v+ i+ GSVIVT01003547001 7 PCAACKLQRRKCTQECIYAPYFPPDQPHKFANVHKVFGASNVAKLLNEINVAHREDAVNSLAYEAEARLHDPVYGCVNSITL 88 7****************************************************************************99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 21.988 | 6 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 8.6E-38 | 7 | 89 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MSSSNSPCAA CKLQRRKCTQ ECIYAPYFPP DQPHKFANVH KVFGASNVAK LLNEINVAHR 60 EDAVNSLAYE AEARLHDPVY GCVNSITLTS SKSITISFSP SCCFRPKHSN AAMLSCTGFW 120 VIQNSTCDLR ILKVTLIHAD N* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-40 | 3 | 92 | 7 | 96 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-40 | 3 | 92 | 7 | 96 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.29474 | 3e-93 | cell culture |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in trichomes, at the base of many lateral organs, including branching points of the inflorescence and floral organs and in the distal part of the pistil at stages when style and stigma start to develop. Also detected in pedicels and at the base of petals and sepals. {ECO:0000269|PubMed:15821980}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM484635 | 1e-136 | AM484635.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X152740.2, clone ENTAV 115. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002263136.3 | 2e-57 | PREDICTED: LOB domain-containing protein 36 | ||||
Swissprot | Q9FKZ3 | 3e-44 | LBD36_ARATH; LOB domain-containing protein 36 | ||||
TrEMBL | A0A438FB10 | 5e-56 | A0A438FB10_VITVI; LOB domain-containing protein 36 | ||||
TrEMBL | A0A438KQT8 | 4e-56 | A0A438KQT8_VITVI; LOB domain-containing protein 36 | ||||
TrEMBL | F6H7Q9 | 4e-56 | F6H7Q9_VITVI; Uncharacterized protein | ||||
STRING | VIT_07s0197g00030.t01 | 6e-57 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66870.1 | 2e-45 | ASYMMETRIC LEAVES 2-like 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01003547001 |
Publications ? help Back to Top | |||
---|---|---|---|
|