PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G66870.1
Common NameASL1, LBD36, MUD21.13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 313aa    MW: 34523.5 Da    PI: 7.1301
Description ASYMMETRIC LEAVES 2-like 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G66870.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.93.6e-4371061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp +qp+kfa+vhk+FGasnv kll++l  ++reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q++++l+ +k
  AT5G66870.1   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFAFVHKVFGASNVAKLLNELASNQREDAVNSLFYEAEARLRDPVYGCVGLISILQHRLKQVNHDLENAK 104
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  AT5G66870.1 105 KE 106
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381553.1E-1214310IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089126.8146107IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MASSSSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFAFVH KVFGASNVAK LLNELASNQR  60
EDAVNSLFYE AEARLRDPVY GCVGLISILQ HRLKQVNHDL ENAKKELATY VGPQAMLPIL  120
QPHFMSLPPQ PQRPSSSSAS VLTQHHHNLL PMMAIPTGQL YHQQQQQIFE AQQLAAVARE  180
QQNEMFRAYG GGGGSSSPHH QNQAQAEILR FNNGFDSVPA GSVTVTGFNQ LSSGGTAVTG  240
MSLGGNFVDS PSTNNNYHTD QQLHHHHQPQ QHHEAQLFIP SQSSQPLPLQ TQETQTQTQP  300
NSESEEGRRN VIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4741108114LOB family transfactor Ramosa2.1
5ly0_B1e-4741108114LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402564920.0
Expression AtlasAT5G66870-
AtGenExpressAT5G66870-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in trichomes, at the base of many lateral organs, including branching points of the inflorescence and floral organs and in the distal part of the pistil at stages when style and stigma start to develop. Also detected in pedicels and at the base of petals and sepals. {ECO:0000269|PubMed:15821980}.
Functional Description ? help Back to Top
Source Description
TAIREncodes LOB domain protein whose overexpression results in KNOX gene repression. Overexpression also results in plants with hyponastic leaves, downward pointing flowers and reduced apical dominance. May be involved in the transcriptional regulation of the homeobox gene BP (brevipedicellus) during lateral organ differentiation. Acts together with AS2 in proximal-distal symmetry determination.
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Function -- GeneRIF ? help Back to Top
  1. SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana
    [PMID: 27605094]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G66870.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G70510(R), AT4G08150(R)
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9FKZ3
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype; due to the partial redundancy with AS2. Gain-of-function mutants iso-3D, iso-4D and dsl1-D (T-DNA and transposon tagging) show flowers and siliques bended downwards. {ECO:0000269|PubMed:12040093}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G66870
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0107000.0AB010700.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MUD21.
GenBankAB1643030.0AB164303.1 Arabidopsis thaliana ASL1 mRNA for ASYMMETRIC LEAVES2-like gene 1 protein, complete cds.
GenBankAB4738340.0AB473834.1 Arabidopsis thaliana ASL1 mRNA for ASYMMETRIC LEAVES2-like 1 protein, complete cds.
GenBankBT0440580.0BT044058.1 Arabidopsis thaliana unknown protein (At5g66870) mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201488.10.0ASYMMETRIC LEAVES 2-like 1
SwissprotQ9FKZ30.0LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A178UE790.0A0A178UE79_ARATH; LBD36
STRINGAT5G66870.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Representative plantOGRP6016318
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Nakazawa M, et al.
    Activation tagging, a novel tool to dissect the functions of a gene family.
    Plant J., 2003. 34(5): p. 741-50
    [PMID:12787254]
  4. Chalfun-Junior A, et al.
    ASYMMETRIC LEAVES2-LIKE1 gene, a member of the AS2/LOB family, controls proximal-distal patterning in Arabidopsis petals.
    Plant Mol. Biol., 2005. 57(4): p. 559-75
    [PMID:15821980]
  5. Phelps-Durr TL,Thomas J,Vahab P,Timmermans MC
    Maize rough sheath2 and its Arabidopsis orthologue ASYMMETRIC LEAVES1 interact with HIRA, a predicted histone chaperone, to maintain knox gene silencing and determinacy during organogenesis.
    Plant Cell, 2005. 17(11): p. 2886-98
    [PMID:16243907]
  6. Okushima Y,Fukaki H,Onoda M,Theologis A,Tasaka M
    ARF7 and ARF19 regulate lateral root formation via direct activation of LBD/ASL genes in Arabidopsis.
    Plant Cell, 2007. 19(1): p. 118-30
    [PMID:17259263]
  7. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  8. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  9. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  10. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  11. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]