PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vun010558 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 186aa MW: 20383.1 Da PI: 4.8818 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 23.2 | 1.5e-07 | 4 | 44 | 5 | 39 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39 C+ +e+ +++ C ++ lC++C +e H H++ Vun010558 4 QCDVCEKAPATVICCADEAVLCAKCDVEVHAAnklaskHQR 44 7*****************************65667777765 PP | |||||||
2 | zf-B_box | 29.2 | 1.9e-09 | 53 | 86 | 2 | 35 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35 + ++C+ +++k + +fC +++ llC+dC + +H Vun010558 53 KLPRCDICQDKAAFIFCVEDRALLCKDCDEPIHV 86 789***************************9994 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50119 | 9.286 | 1 | 47 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 2.67E-6 | 3 | 47 | No hit | No description |
SMART | SM00336 | 1.8E-9 | 4 | 47 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 1.2E-5 | 4 | 44 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 1.0E-15 | 52 | 99 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 9.485 | 52 | 99 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 9.8E-8 | 53 | 95 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 2.29E-6 | 55 | 98 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005622 | Cellular Component | intracellular | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MKIQCDVCEK APATVICCAD EAVLCAKCDV EVHAANKLAS KHQRLLLQCL SNKLPRCDIC 60 QDKAAFIFCV EDRALLCKDC DEPIHVAGSL SANHQRFLAT GIRVALGSNC TKGNEKGHME 120 PSNPNAQEVP VKVPSQQVPS FTSSWAVDDL LELTDFESPD KAQKQSLEFG ELEWLADAVF 180 LVNSFX |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as negative regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation (PubMed:17605755, PubMed:18540109, PubMed:21685177). BBX24/STO and BBX25/STH function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX24/STO acts additively with BBX25/STH during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). Functions as negative regulator of photomorphogenic UV-B responses by interacting with both COP1 and HY5 (PubMed:22410790). May act as a transcription factor in the salt-stress response (PubMed:12909688). {ECO:0000269|PubMed:12909688, ECO:0000269|PubMed:17605755, ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:21685177, ECO:0000269|PubMed:22410790, ECO:0000269|PubMed:23624715}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak before dawn. {ECO:0000269|PubMed:17605755}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027910885.1 | 1e-129 | B-box zinc finger protein 24 | ||||
Swissprot | Q96288 | 3e-75 | BBX24_ARATH; B-box zinc finger protein 24 | ||||
TrEMBL | A0A4D6LIF0 | 1e-127 | A0A4D6LIF0_VIGUN; Zinc finger protein CONSTANS | ||||
STRING | XP_007131941.1 | 1e-122 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06040.1 | 3e-75 | DBB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|