PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G06040.1

Common Name

BBX24, STO, T21E18.8, T21E18.9

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

DBB

Protein Properties

Length: 248aa MW: 27641 Da PI: 5.5272

Description

DBB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G06040.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-B_box	22.4	2.5e-07	4	43	5	38
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38 C+ +e+ +++ C ++ lC++C e+H H+ AT1G06040.1 4 QCDVCEKAPATVICCADEAALCPQCDIEIHAAnklaskHQ 43 7*****************************6566676765 PP
2	zf-B_box	30.3	8.5e-10	55	86	4	35
zf-B_box 4 rkCpeHeekelqlfCedCqqllCedClleeHk 35 ++C+ ++ek + +fC +++ llC+dC +++H AT1G06040.1 55 PRCDICQEKAAFIFCVEDRALLCRDCDESIHV 86 79*****************************4 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50119	9.172	1	47	IPR000315	B-box-type zinc finger
CDD	cd00021	1.24E-5	3	45	No hit	No description
SMART	SM00336	3.2E-7	4	47	IPR000315	B-box-type zinc finger
PROSITE profile	PS50119	9.684	52	99	IPR000315	B-box-type zinc finger
SMART	SM00336	1.4E-16	52	99	IPR000315	B-box-type zinc finger
Pfam	PF00643	1.3E-7	55	95	IPR000315	B-box-type zinc finger
CDD	cd00021	1.21E-8	55	98	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009640	Biological Process	photomorphogenesis
GO:0009651	Biological Process	response to salt stress
GO:0048573	Biological Process	photoperiodism, flowering
GO:0080167	Biological Process	response to karrikin
GO:0090351	Biological Process	seedling development
GO:1902448	Biological Process	positive regulation of shade avoidance
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0003712	Molecular Function	transcription cofactor activity
GO:0005515	Molecular Function	protein binding
GO:0008270	Molecular Function	zinc ion binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000084	anatomy	plant sperm cell
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 248 aa Download sequence Send to blast
MKIQCDVCEK APATVICCAD EAALCPQCDI EIHAANKLAS KHQRLHLNSL STKFPRCDIC 60 QEKAAFIFCV EDRALLCRDC DESIHVANSR SANHQRFLAT GIKVALTSTI CSKEIEKNQP 120 EPSNNQQKAN QIPAKSTSQQ QQQPSSATPL PWAVDDFFHF SDIESTDKKG QLDLGAGELD 180 WFSDMGFFGD QINDKALPAA EVPELSVSHL GHVHSYKPMK SNVSHKKPRF ETRYDDDDEE 240 HFIVPDLG

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.23289	0.0	flower\| inflorescence\| leaf\| root\| seed\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	260956_at	0.0
Expression Atlas	AT1G06040	-
AtGenExpress	AT1G06040	-
ATTED-II	AT1G06040	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: High expression in leaves and lower in roots and flowers.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes salt tolerance protein (STO) which confers salt tolerance to yeast cells. Fully complements calcineurin deficient yeast but does not encode a phosphoprotein phosphatase. Sequence has similarities to CONSTANS. STO co-localizes with COP1 and plays a role in light signaling.
UniProt	Acts as negative regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation (PubMed:17605755, PubMed:18540109, PubMed:21685177). BBX24/STO and BBX25/STH function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX24/STO acts additively with BBX25/STH during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). Functions as negative regulator of photomorphogenic UV-B responses by interacting with both COP1 and HY5 (PubMed:22410790). May act as a transcription factor in the salt-stress response (PubMed:12909688). {ECO:0000269\|PubMed:12909688, ECO:0000269\|PubMed:17605755, ECO:0000269\|PubMed:18540109, ECO:0000269\|PubMed:21685177, ECO:0000269\|PubMed:22410790, ECO:0000269\|PubMed:23624715}.

Function -- GeneRIF ? help Back to Top
Microscopic analysis revealed that the STO:eGFP fusion protein is located in the nucleus. [PMID: 17605755] Mutations in the region responsible for the interaction with COP1 revealed that a physical interaction of the proteins is also required for degradation of BBX24 in the light and for normal photomorphogenesis. [PMID: 21685177] STO/BBX24 functions as a negative regulator of photomorphogenic UV-B responses by interacting with both COP1 and HY5. [PMID: 22410790] Data suggest that BBX25 (At2g31380) and BBX24 (At1g06040) function as transcriptional corepressors, probably by forming inactive heterodimers with HY5 (At5g11260) downregulating BBX22 (AT1G78600) expression for the light-mediated seedling development. [PMID: 23624715] BX24 and BBX25 physically interact with HYH which leads to depletion of HYH molecules from the active pool and, thus indirectly, reduce the function of HY5 in promoting photomorphogenesis. [BBX24] [PMID: 23733077] Data indicate that the expression of the B-box family gene STO (BBX24) is controlled by circadian rhythm and is affected by environmental factors and phytohormones [PMID: 24498334] BBX24 physically interacts with DELLA proteins and alleviates DELLA-mediated repression of PIF4 activity.[BBX24] [PMID: 25656233] Findings indicate that both B-Box Proteins BBX21 and BBX24 regulate ELONGATED HYPOCOTYL 5 protein (HY5) activity post-transcriptionally, in opposite ways. [PMID: 29439209]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G06040.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak before dawn. {ECO:0000269\|PubMed:17605755}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G14920
IntAct	Search Q96288

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions, but mutant seedlings show reduction of hypocotyls length when grown under continous blue light and a short primary root phenotype under UV-B radiation. {ECO:0000269\|PubMed:17605755, ECO:0000269\|PubMed:22410790}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G06040

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY045794	0.0	AY045794.1 Arabidopsis thaliana putative salt-tolerance protein (At1g06040) mRNA, complete cds.
GenBank	AY079377	0.0	AY079377.1 Arabidopsis thaliana putative salt-tolerance protein (At1g06040) mRNA, complete cds.
GenBank	X95572	0.0	X95572.1 A.thaliana mRNA for salt-tolerance protein.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_172094.1	0.0	B-box zinc finger family protein
Swissprot	Q96288	0.0	BBX24_ARATH; B-box zinc finger protein 24
TrEMBL	A0A178W110	0.0	A0A178W110_ARATH; STO
STRING	AT1G06040.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2711	27	67
Representative plant	OGRP5397	10	20

Link Out ? help Back to Top
Phytozome	AT1G06040.1
Entrez Gene	837113
iHOP	AT1G06040
wikigenes	AT1G06040

Publications ? help Back to Top
Belles-Boix E,Babiychuk E,Van Montagu M,Inzé D,Kushnir S CEO1, a new protein from Arabidopsis thaliana, protects yeast against oxidative damage. FEBS Lett., 2000. 482(1-2): p. 19-24 [PMID:11018516] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Holm M,Hardtke CS,Gaudet R,Deng XW Identification of a structural motif that confers specific interaction with the WD40 repeat domain of Arabidopsis COP1. EMBO J., 2001. 20(1-2): p. 118-27 [PMID:11226162] Nagaoka S,Takano T Salt tolerance-related protein STO binds to a Myb transcription factor homologue and confers salt tolerance in Arabidopsis. J. Exp. Bot., 2003. 54(391): p. 2231-7 [PMID:12909688] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Cheng Y,Long M A cytosolic NADP-malic enzyme gene from rice (Oryza sativa L.) confers salt tolerance in transgenic Arabidopsis. Biotechnol. Lett., 2007. 29(7): p. 1129-34 [PMID:17516134] Chen LH,Zhang B,Xu ZQ Salt tolerance conferred by overexpression of Arabidopsis vacuolar Na(+)/H (+) antiporter gene AtNHX1 in common buckwheat (Fagopyrum esculentum). Transgenic Res., 2008. 17(1): p. 121-32 [PMID:17541720] Zhao J,Zhi D,Xue Z,Liu H,Xia G Enhanced salt tolerance of transgenic progeny of tall fescue (Festuca arundinacea) expressing a vacuolar Na+/H+ antiporter gene from Arabidopsis. J. Plant Physiol., 2007. 164(10): p. 1377-83 [PMID:17561307] Obata T,Kitamoto HK,Nakamura A,Fukuda A,Tanaka Y Rice shaker potassium channel OsKAT1 confers tolerance to salinity stress on yeast and rice cells. Plant Physiol., 2007. 144(4): p. 1978-85 [PMID:17586689] Indorf M,Cordero J,Neuhaus G,Rodríguez-Franco M Salt tolerance (STO), a stress-related protein, has a major role in light signalling. Plant J., 2007. 51(4): p. 563-74 [PMID:17605755] Datta S,Hettiarachchi C,Johansson H,Holm M SALT TOLERANCE HOMOLOG2, a B-box protein in Arabidopsis that activates transcription and positively regulates light-mediated development. Plant Cell, 2007. 19(10): p. 3242-55 [PMID:17965270] Papdi C, et al. Functional identification of Arabidopsis stress regulatory genes using the controlled cDNA overexpression system. Plant Physiol., 2008. 147(2): p. 528-42 [PMID:18441225] Kumagai T, et al. The common function of a novel subfamily of B-Box zinc finger proteins with reference to circadian-associated events in Arabidopsis thaliana. Biosci. Biotechnol. Biochem., 2008. 72(6): p. 1539-49 [PMID:18540109] Du J, et al. Functional gene-mining for salt-tolerance genes with the power of Arabidopsis. Plant J., 2008. 56(4): p. 653-64 [PMID:18643972] Ding Z, et al. Transgenic expression of MYB15 confers enhanced sensitivity to abscisic acid and improved drought tolerance in Arabidopsis thaliana. J Genet Genomics, 2009. 36(1): p. 17-29 [PMID:19161942] Park MY, et al. Isolation and functional characterization of the Arabidopsis salt-tolerance 32 (AtSAT32) gene associated with salt tolerance and ABA signaling. Physiol Plant, 2009. 135(4): p. 426-35 [PMID:19210750] Kl Expression of the ggpPS gene for glucosylglycerol biosynthesis from Azotobacter vinelandii improves the salt tolerance of Arabidopsis thaliana. J. Exp. Bot., 2009. 60(6): p. 1679-89 [PMID:19363207] Wang H,Liang X,Wan Q,Wang X,Bi Y Ethylene and nitric oxide are involved in maintaining ion homeostasis in Arabidopsis callus under salt stress. Planta, 2009. 230(2): p. 293-307 [PMID:19455351] Jiang L,Wang Y,Bj Arabidopsis radical-induced cell death1 is involved in UV-B signaling. Photochem. Photobiol. Sci., 2009. 8(6): p. 838-46 [PMID:19492112] Jaspers P, et al. Unequally redundant RCD1 and SRO1 mediate stress and developmental responses and interact with transcription factors. Plant J., 2009. 60(2): p. 268-79 [PMID:19548978] Oh DH, et al. Loss of halophytism by interference with SOS1 expression. Plant Physiol., 2009. 151(1): p. 210-22 [PMID:19571313] Datta S,Johansson H,Hettiarachchi C,Holm M STH2 has 2 B there: An insight into the role of B-box containing proteins in Arabidopsis. Plant Signal Behav, 2008. 3(8): p. 547-8 [PMID:19704462] Rodriguez-Franco M,Sarmiento F,Marquardt K,Markus R,Neuhaus G Does light taste salty? Plant Signal Behav, 2008. 3(1): p. 72-3 [PMID:19704777] Hamaji K, et al. Dynamic aspects of ion accumulation by vesicle traffic under salt stress in Arabidopsis. Plant Cell Physiol., 2009. 50(12): p. 2023-33 [PMID:19880402] Khanna R, et al. The Arabidopsis B-box zinc finger family. Plant Cell, 2009. 21(11): p. 3416-20 [PMID:19920209] Zhou GA,Chang RZ,Qiu LJ Overexpression of soybean ubiquitin-conjugating enzyme gene GmUBC2 confers enhanced drought and salt tolerance through modulating abiotic stress-responsive gene expression in Arabidopsis. Plant Mol. Biol., 2010. 72(4-5): p. 357-67 [PMID:19941154] Smith CA,Melino VJ,Sweetman C,Soole KL Manipulation of alternative oxidase can influence salt tolerance in Arabidopsis thaliana. Physiol Plant, 2009. 137(4): p. 459-72 [PMID:19941623] Jha D,Shirley N,Tester M,Roy SJ Variation in salinity tolerance and shoot sodium accumulation in Arabidopsis ecotypes linked to differences in the natural expression levels of transporters involved in sodium transport. Plant Cell Environ., 2010. 33(5): p. 793-804 [PMID:20040066] Nelson DC, et al. Karrikins enhance light responses during germination and seedling development in Arabidopsis thaliana. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(15): p. 7095-100 [PMID:20351290] Gao Z, et al. Overexpressing a putative aquaporin gene from wheat, TaNIP, enhances salt tolerance in transgenic Arabidopsis. Plant Cell Physiol., 2010. 51(5): p. 767-75 [PMID:20360019] Xu K,Zhang H,Blumwald E,Xia T A novel plant vacuolar Na+/H+ antiporter gene evolved by DNA shuffling confers improved salt tolerance in yeast. J. Biol. Chem., 2010. 285(30): p. 22999-3006 [PMID:20457597] Pasapula V, et al. Expression of an Arabidopsis vacuolar H+-pyrophosphatase gene (AVP1) in cotton improves drought- and salt tolerance and increases fibre yield in the field conditions. Plant Biotechnol. J., 2011. 9(1): p. 88-99 [PMID:20492547] Wang H, et al. Involvement of ethylene and hydrogen peroxide in induction of alternative respiratory pathway in salt-treated Arabidopsis calluses. Plant Cell Physiol., 2010. 51(10): p. 1754-65 [PMID:20801923] Jossier M, et al. The Arabidopsis vacuolar anion transporter, AtCLCc, is involved in the regulation of stomatal movements and contributes to salt tolerance. Plant J., 2010. 64(4): p. 563-76 [PMID:20822503] Jacoby RP,Millar AH,Taylor NL Wheat mitochondrial proteomes provide new links between antioxidant defense and plant salinity tolerance. J. Proteome Res., 2010. 9(12): p. 6595-604 [PMID:21043471] Zhang X, et al. The R-R-type MYB-like transcription factor, AtMYBL, is involved in promoting leaf senescence and modulates an abiotic stress response in Arabidopsis. Plant Cell Physiol., 2011. 52(1): p. 138-48 [PMID:21097474] Zhang Z, et al. Arabidopsis floral initiator SKB1 confers high salt tolerance by regulating transcription and pre-mRNA splicing through altering histone H4R3 and small nuclear ribonucleoprotein LSM4 methylation. Plant Cell, 2011. 23(1): p. 396-411 [PMID:21258002] Xianjun P, et al. Improved drought and salt tolerance of Arabidopsis thaliana by transgenic expression of a novel DREB gene from Leymus chinensis. Plant Cell Rep., 2011. 30(8): p. 1493-502 [PMID:21509473] Li J,Wang X,Zhang Y,Jia H,Bi Y cGMP regulates hydrogen peroxide accumulation in calcium-dependent salt resistance pathway in Arabidopsis thaliana roots. Planta, 2011. 234(4): p. 709-22 [PMID:21617988] Chen S, et al. Transcriptome sequencing of a highly salt tolerant mangrove species Sonneratia alba using Illumina platform. Mar Genomics, 2011. 4(2): p. 129-36 [PMID:21620334] Ying S, et al. Cloning and characterization of a maize SnRK2 protein kinase gene confers enhanced salt tolerance in transgenic Arabidopsis. Plant Cell Rep., 2011. 30(9): p. 1683-99 [PMID:21638061] Yan H, et al. Nuclear localization and interaction with COP1 are required for STO/BBX24 function during photomorphogenesis. Plant Physiol., 2011. 156(4): p. 1772-82 [PMID:21685177] Zhang L, et al. An AP2 domain-containing gene, ESE1, targeted by the ethylene signaling component EIN3 is important for the salt response in Arabidopsis. Plant Physiol., 2011. 157(2): p. 854-65 [PMID:21832142] Yamawaki S,Yamashino T,Nakamichi N,Nakanishi H,Mizuno T Light-responsive double B-box containing transcription factors are conserved in Physcomitrella patens. Biosci. Biotechnol. Biochem., 2011. 75(10): p. 2037-41 [PMID:21979077] Zhao X,Wang M,Quan T,Xia G The role of TaCHP in salt stress responsive pathways. Plant Signal Behav, 2012. 7(1): p. 71-4 [PMID:22301971] Wang RK, et al. Molecular cloning and functional characterization of a novel apple MdCIPK6L gene reveals its involvement in multiple abiotic stress tolerance in transgenic plants. Plant Mol. Biol., 2012. 79(1-2): p. 123-35 [PMID:22382993] Jiang L, et al. Arabidopsis STO/BBX24 negatively regulates UV-B signaling by interacting with COP1 and repressing HY5 transcriptional activity. Cell Res., 2012. 22(6): p. 1046-57 [PMID:22410790] Zhou ML, et al. Improvement of drought and salt tolerance in Arabidopsis and Lotus corniculatus by overexpression of a novel DREB transcription factor from Populus euphratica. Gene, 2012. 506(1): p. 10-7 [PMID:22771912] Ford BA,Ernest JR,Gendall AR Identification and characterization of orthologs of AtNHX5 and AtNHX6 in Brassica napus. Front Plant Sci, 2012. 3: p. 208 [PMID:22973287] Ye J,Zhang W,Guo Y Arabidopsis SOS3 plays an important role in salt tolerance by mediating calcium-dependent microfilament reorganization. Plant Cell Rep., 2013. 32(1): p. 139-48 [PMID:23052592] Xie Y,Mao Y,Lai D,Zhang W,Shen W H(2) enhances arabidopsis salt tolerance by manipulating ZAT10/12-mediated antioxidant defence and controlling sodium exclusion. PLoS ONE, 2012. 7(11): p. e49800 [PMID:23185443] Tezuka K,Taji T,Hayashi T,Sakata Y A novel abi5 allele reveals the importance of the conserved Ala in the C3 domain for regulation of downstream genes and salt tolerance during germination in Arabidopsis. Plant Signal Behav, 2013. 8(3): p. e23455 [PMID:23299338] Ellouzi H, et al. Increased sensitivity to salt stress in tocopherol-deficient Arabidopsis mutants growing in a hydroponic system. Plant Signal Behav, 2013. 8(2): p. e23136 [PMID:23299430] Li X, et al. A novel salt-induced gene from sheepgrass, LcSAIN2, enhances salt tolerance in transgenic Arabidopsis. Plant Physiol. Biochem., 2013. 64: p. 52-9 [PMID:23353766] Sarmiento F The BBX subfamily IV: additional cogs and sprockets to fine-tune light-dependent development. Plant Signal Behav, 2013. 8(4): p. e23831 [PMID:23425851] L RhEXPA4, a rose expansin gene, modulates leaf growth and confers drought and salt tolerance to Arabidopsis. Planta, 2013. 237(6): p. 1547-59 [PMID:23503758] Gangappa SN, et al. The Arabidopsis B-BOX protein BBX25 interacts with HY5, negatively regulating BBX22 expression to suppress seedling photomorphogenesis. Plant Cell, 2013. 25(4): p. 1243-57 [PMID:23624715] Chen L, et al. Arabidopsis CBL-interacting protein kinase (CIPK6) is involved in plant response to salt/osmotic stress and ABA. Mol. Biol. Rep., 2013. 40(8): p. 4759-67 [PMID:23649767] Kim DY,Scalf M,Smith LM,Vierstra RD Advanced proteomic analyses yield a deep catalog of ubiquitylation targets in Arabidopsis. Plant Cell, 2013. 25(5): p. 1523-40 [PMID:23667124] Gangappa SN,Holm M,Botto JF Molecular interactions of BBX24 and BBX25 with HYH, HY5 HOMOLOG, to modulate Arabidopsis seedling development. Plant Signal Behav, 2014. [PMID:23733077] Tilbrook K, et al. The UVR8 UV-B Photoreceptor: Perception, Signaling and Response. Arabidopsis Book, 2013. 11: p. e0164 [PMID:23864838] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li F, et al. The B-box family gene STO (BBX24) in Arabidopsis thaliana regulates flowering time in different pathways. PLoS ONE, 2014. 9(2): p. e87544 [PMID:24498334] Crocco CD, et al. The transcriptional regulator BBX24 impairs DELLA activity to promote shade avoidance in Arabidopsis thaliana. Nat Commun, 2015. 6: p. 6202 [PMID:25656233] Imtiaz M, et al. Identification and functional characterization of the BBX24 promoter and gene from chrysanthemum in Arabidopsis. Plant Mol. Biol., 2015. 89(1-2): p. 1-19 [PMID:26253592] Job N,Yadukrishnan P,Bursch K,Datta S,Johansson H Two B-Box Proteins Regulate Photomorphogenesis by Oppositely Modulating HY5 through their Diverse C-Terminal Domains. Plant Physiol., 2018. 176(4): p. 2963-2976 [PMID:29439209] Lippuner V,Cyert MS,Gasser CS Two classes of plant cDNA clones differentially complement yeast calcineurin mutants and increase salt tolerance of wild-type yeast. J. Biol. Chem., 1996. 271(22): p. 12859-66 [PMID:8662738] Song J, et al. Isolation and mapping of a family of putative zinc-finger protein cDNAs from rice. DNA Res., 1998. 5(2): p. 95-101 [PMID:9679197]