PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vun010348

Organism

Vigna unguiculata

Taxonomic ID

3917

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

NAC

Protein Properties

Length: 195aa MW: 22054.9 Da PI: 10.2472

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Vun#S50218249	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	167.9	3.4e-52	14	139	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100 lppGfrF Ptdeel+v+yL++kv+g++++l +i+e+d+yk++Pw Lp+k+ +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g++v Vun010348 14 LPPGFRFYPTDEELLVQYLCRKVAGHHFSL-PIIAEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT-EGRKV 111 79************************99.88***********7777799*******************************9999.999 PP NAM 101 glkktLvfykgrapkgektdWvmheyrl 128 g+kk Lvfy g+apkg+kt+W+mheyrl Vun010348 112 GIKKALVFYVGKAPKGTKTNWIMHEYRL 139 **************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.22E-67	10	163	IPR003441	NAC domain
PROSITE profile	PS51005	60.161	14	162	IPR003441	NAC domain
Pfam	PF02365	7.4E-27	15	139	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 195 aa Download sequence Send to blast
MGVPEKDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAGHH FSLPIIAEID LYKFDPWVLP 60 SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITTEGRK VGIKKALVFY 120 VGKAPKGTKT NWIMHEYRLL DSTRKNTGTK LDDWVLCRIY KKNSSAQKAV QNGIVSSRGH 180 TQYSNGSSSS SSSHX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3swm_A	1e-110	1	168	7	174	NAC domain-containing protein 19
3swm_B	1e-110	1	168	7	174	NAC domain-containing protein 19
3swm_C	1e-110	1	168	7	174	NAC domain-containing protein 19
3swm_D	1e-110	1	168	7	174	NAC domain-containing protein 19
3swp_A	1e-110	1	168	7	174	NAC domain-containing protein 19
3swp_B	1e-110	1	168	7	174	NAC domain-containing protein 19
3swp_C	1e-110	1	168	7	174	NAC domain-containing protein 19
3swp_D	1e-110	1	168	7	174	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269\|PubMed:15319476}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Strongly induced by high salinity. Slightly up-regulated by drought, abscisic acid (ABA) and jasmonic acid. Not induced by cold treatment. {ECO:0000269\|PubMed:15319476}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027929469.1	1e-140	NAC domain-containing protein 72
Swissprot	Q9LDY8	1e-112	NAC55_ARATH; NAC domain-containing protein 55
TrEMBL	A0A4D6NAT7	1e-139	A0A4D6NAT7_VIGUN; Uncharacterized protein
STRING	XP_007149614.1	1e-134	(Phaseolus vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G15500.1	1e-113	NAC domain containing protein 3

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Zheng XY, et al. Coronatine promotes Pseudomonas syringae virulence in plants by activating a signaling cascade that inhibits salicylic acid accumulation. Cell Host Microbe, 2012. 11(6): p. 587-96 [PMID:22704619] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhu X, et al. Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes. Plant J., 2015. 84(3): p. 597-610 [PMID:26407000] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Gimenez-Ibanez S, et al. JAZ2 controls stomata dynamics during bacterial invasion. New Phytol., 2017. 213(3): p. 1378-1392 [PMID:28005270] Hickman R, et al. Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network. Plant Cell, 2017. 29(9): p. 2086-2105 [PMID:28827376] Fu Y,Ma H,Chen S,Gu T,Gong J Control of proline accumulation under drought via a novel pathway comprising the histone methylase CAU1 and the transcription factor ANAC055. J. Exp. Bot., 2018. 69(3): p. 579-588 [PMID:29253181]