PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi05g11580.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 163aa MW: 18564.4 Da PI: 5.3545 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 74.8 | 1e-23 | 115 | 160 | 1 | 46 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTT CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpk 46 +dDg++WrKYG+K+vk+s++pr+YYrC+ +gC+vkk ver+++dp+ Vradi05g11580.1 115 MDDGFKWRKYGKKMVKNSPNPRNYYRCSVEGCSVKKVVERDKDDPS 160 59****************************************9985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.5E-25 | 102 | 160 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.7E-21 | 108 | 160 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 23.204 | 110 | 162 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.2E-18 | 115 | 162 | IPR003657 | WRKY domain |
Pfam | PF03106 | 8.2E-18 | 116 | 159 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MCAVVHSFRI NGVKMSGDNP KAPDSPENDF TKQWPSELSE YLNLDDDPWS YDDLESFVSG 60 HAFSHKTEAN EVGELGGSST HHEEFSIRDD GINEHEKKEV RDRVAFKTKS EIEIMDDGFK 120 WRKYGKKMVK NSPNPRNYYR CSVEGCSVKK VVERDKDDPS GR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-18 | 105 | 159 | 7 | 61 | Probable WRKY transcription factor 4 |
2lex_A | 5e-18 | 105 | 159 | 7 | 61 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi05g11580.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 1e-113 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014500793.1 | 1e-116 | probable WRKY transcription factor 50 isoform X1 | ||||
Swissprot | Q8VWQ5 | 5e-33 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A1S3U437 | 1e-114 | A0A1S3U437_VIGRR; probable WRKY transcription factor 50 isoform X1 | ||||
STRING | XP_007136862.1 | 4e-72 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1120 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 2e-35 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|