PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vradi05g02100.1

Organism

Vigna radiata

Taxonomic ID

157791

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

MYB_related

Protein Properties

Length: 133aa MW: 15466.8 Da PI: 10.3662

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vradi05g02100.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.5	5.7e-17	11	57	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g+W+ +Ede+l+++v++ G g+W+ +++ g++R++++ck+rw++yl Vradi05g02100.1 11 GAWSSDEDEILLNYVQLTGEGNWTDLPQRAGLKRCGESCKHRWLNYL 57 89********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	18.274	1	61	IPR017930	Myb domain
SMART	SM00717	5.7E-11	9	59	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	7.4E-18	9	60	IPR009057	Homeodomain-like
Pfam	PF00249	5.0E-15	11	57	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	7.76E-20	11	84	IPR009057	Homeodomain-like
CDD	cd00167	4.95E-8	12	57	No hit	No description
Gene3D	G3DSA:1.10.10.60	6.3E-4	61	84	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 133 aa Download sequence Send to blast
METKKCCEKE GAWSSDEDEI LLNYVQLTGE GNWTDLPQRA GLKRCGESCK HRWLNYLKQT 60 IPGDNFSWDE QELIIKLHKL LGNRGGRRLS VILLRHDSAA QKQKNKKKGE RIKGNLIGGL 120 PRRWRRWYKN FS*

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vradi05g02100.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014500543.1	9e-57	transcription factor MYB114
Swissprot	P10290	2e-27	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	A0A1S3U3E1	2e-55	A0A1S3U3E1_VIGRR; transcription factor MYB114
STRING	XP_007138671.1	4e-46	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G16720.1	3e-27	myb domain protein 7

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]