Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 56.3 | 7.1e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEde+lv ++k +G g+W++ +r g+ R++k+c++rw +yl
AT2G16720.1 14 KGAWTKEEDERLVSYIKSHGEGCWRSLPRAAGLLRCGKSCRLRWINYL 61
79******************************99************97 PP
|
2 | Myb_DNA-binding | 57.6 | 2.9e-18 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
rg++T +Edel+++++ +lG++ W++Ia++++ gRt++++k++w+++
AT2G16720.1 67 RGNFTHDEDELIIKLHSLLGNK-WSLIAARLP-GRTDNEIKNYWNTH 111
89********************.*********.************97 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] - Truman W,de Zabala MT,Grant M
Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance. Plant J., 2006. 46(1): p. 14-33 [PMID:16553893] - Ditt RF, et al.
The Arabidopsis thaliana transcriptome in response to Agrobacterium tumefaciens. Mol. Plant Microbe Interact., 2006. 19(6): p. 665-81 [PMID:16776300] - Ma S,Bohnert HJ
Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression. Genome Biol., 2007. 8(4): p. R49 [PMID:17408486] - Catala R, et al.
The Arabidopsis E3 SUMO ligase SIZ1 regulates plant growth and drought responses. Plant Cell, 2007. 19(9): p. 2952-66 [PMID:17905899] - Dubos C, et al.
MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana. Plant J., 2008. 55(6): p. 940-53 [PMID:18532978] - Huang D,Wu W,Abrams SR,Cutler AJ
The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors. J. Exp. Bot., 2008. 59(11): p. 2991-3007 [PMID:18552355] - Causier B,Ashworth M,Guo W,Davies B
The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] - Fornal
AtMYB7, a new player in the regulation of UV-sunscreens in Arabidopsis thaliana. Plant Cell Physiol., 2014. 55(3): p. 507-16 [PMID:24319076] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Kim JH, et al.
AtMyb7, a subgroup 4 R2R3 Myb, negatively regulates ABA-induced inhibition of seed germination by blocking the expression of the bZIP transcription factor ABI5. Plant Cell Environ., 2015. 38(3): p. 559-71 [PMID:25053018] - Zhou M, et al.
Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] - Lotkowska ME, et al.
The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress. Plant Physiol., 2015. 169(3): p. 1862-80 [PMID:26378103] - Zhou M, et al.
LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] - Mondal SK,Roy S
Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] - Li SF,Parish RW
Isolation of two novel myb-like genes from Arabidopsis and studies on the DNA-binding properties of their products. Plant J., 1995. 8(6): p. 963-72 [PMID:8580966] - Quaedvlieg N, et al.
Identification of a light-regulated MYB gene from an Arabidopsis transcription factor gene collection. Plant Mol. Biol., 1996. 32(5): p. 987-93 [PMID:8980549] - Kranz HD, et al.
Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]
|