PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G16720.1

Common Name

ATMYB7, ATY49, MYB7, Y49

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 269aa MW: 31009.3 Da PI: 8.7736

Description

myb domain protein 7

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G16720.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.3	7.1e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+lv ++k +G g+W++ +r g+ R++k+c++rw +yl AT2G16720.1 14 KGAWTKEEDERLVSYIKSHGEGCWRSLPRAAGLLRCGKSCRLRWINYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	57.6	2.9e-18	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T +Edel+++++ +lG++ W++Ia++++ gRt++++k++w+++ AT2G16720.1 67 RGNFTHDEDELIIKLHSLLGNK-WSLIAARLP-GRTDNEIKNYWNTH 111 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	9.0E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.094	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	1.8E-29	12	108	IPR009057	Homeodomain-like
SMART	SM00717	2.2E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	3.6E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	2.51E-9	16	61	No hit	No description
PROSITE profile	PS51294	28.751	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	7.7E-28	65	116	IPR009057	Homeodomain-like
SMART	SM00717	3.2E-17	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	1.2E-16	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	5.75E-11	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009651	Biological Process	response to salt stress
GO:0009751	Biological Process	response to salicylic acid
GO:0030154	Biological Process	cell differentiation
GO:1900384	Biological Process	regulation of flavonol biosynthetic process
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 269 aa Download sequence Send to blast
MGRSPCCEKE HMNKGAWTKE EDERLVSYIK SHGEGCWRSL PRAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF THDEDELIIK LHSLLGNKWS LIAARLPGRT DNEIKNYWNT HIKRKLLSKG 120 IDPATHRGIN EAKISDLKKT KDQIVKDVSF VTKFEETDKS GDQKQNKYIR NGLVCKEERV 180 VVEEKIGPDL NLELRISPPW QNQREISTCT ASRFYMENDM ECSSETVKCQ TENSSSISYS 240 SIDISSSNVG YDFLGLKTRI LDFRSLEMK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-28	12	116	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.5349	0.0	root

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	186500825	0.0
Genevisible	265359_at	0.0
Expression Atlas	AT2G16720	-
AtGenExpress	AT2G16720	-
ATTED-II	AT2G16720	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in anthers (PubMed:24319076, PubMed:25053018). Expressed in pollen grains and mature seeds (PubMed:25053018). Expressed in roots and vasculature of leaves (PubMed:24319076). {ECO:0000269\|PubMed:24319076, ECO:0000269\|PubMed:25053018}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of MYB3R- and R2R3- type MYB- encoding genes
UniProt	Transcription factor involved in the negative regulation of flavonol biosynthesis. Represses the early phenylpropanoid genes, phenylalanine ammonia-lyase (PAL), cinnamate 4-hydroxylase (C4H) and 4-coumarate-CoA ligase (4CL), as well as the flavonoid-specific genes, flavonoid 3'-hydroxylase (F3'H) and dihydroflavonol 4-reductase (DFR) (PubMed:24319076). Plays a role in seed germination inhibition. Negatively regulates the expression of the abscisic acid (ABA) signaling transcription factor ABI5 in seeds (PubMed:25053018). {ECO:0000269\|PubMed:24319076, ECO:0000269\|PubMed:25053018}.

Function -- GeneRIF ? help Back to Top
AtMyb7 negatively controls the expression of the gene encoding bZIP transcription factor, ABI5, which is a key transcription factor in abscisic acid (ABA) signalling and serves as a crucial regulator of germination inhibition in Arabidopsis. [PMID: 25053018]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G16720.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and osmotic stress (PubMed:25053018). Induced by salt stress (PubMed:24319076, PubMed:25053018). {ECO:0000269\|PubMed:24319076, ECO:0000269\|PubMed:25053018}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, ethylene, gibberellin, jasmonic acid, salicylic acid

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G16720

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	ATU26937	0.0	U26937.1 Arabidopsis thaliana clone myb7 DNA-binding protein mRNA, complete cds.
GenBank	AY519573	0.0	AY519573.1 Arabidopsis thaliana MYB transcription factor (At2g16720) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_179263.1	0.0	myb domain protein 7
Swissprot	Q42379	0.0	MYB7_ARATH; Transcription factor MYB7
TrEMBL	A0A178VU32	0.0	A0A178VU32_ARATH; MYB7
STRING	AT2G16720.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT2G16720.1
Entrez Gene	816173
iHOP	AT2G16720
wikigenes	AT2G16720

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Truman W,de Zabala MT,Grant M Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance. Plant J., 2006. 46(1): p. 14-33 [PMID:16553893] Ditt RF, et al. The Arabidopsis thaliana transcriptome in response to Agrobacterium tumefaciens. Mol. Plant Microbe Interact., 2006. 19(6): p. 665-81 [PMID:16776300] Ma S,Bohnert HJ Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression. Genome Biol., 2007. 8(4): p. R49 [PMID:17408486] Catala R, et al. The Arabidopsis E3 SUMO ligase SIZ1 regulates plant growth and drought responses. Plant Cell, 2007. 19(9): p. 2952-66 [PMID:17905899] Dubos C, et al. MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana. Plant J., 2008. 55(6): p. 940-53 [PMID:18532978] Huang D,Wu W,Abrams SR,Cutler AJ The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors. J. Exp. Bot., 2008. 59(11): p. 2991-3007 [PMID:18552355] Causier B,Ashworth M,Guo W,Davies B The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] Fornal AtMYB7, a new player in the regulation of UV-sunscreens in Arabidopsis thaliana. Plant Cell Physiol., 2014. 55(3): p. 507-16 [PMID:24319076] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kim JH, et al. AtMyb7, a subgroup 4 R2R3 Myb, negatively regulates ABA-induced inhibition of seed germination by blocking the expression of the bZIP transcription factor ABI5. Plant Cell Environ., 2015. 38(3): p. 559-71 [PMID:25053018] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Lotkowska ME, et al. The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress. Plant Physiol., 2015. 169(3): p. 1862-80 [PMID:26378103] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Li SF,Parish RW Isolation of two novel myb-like genes from Arabidopsis and studies on the DNA-binding properties of their products. Plant J., 1995. 8(6): p. 963-72 [PMID:8580966] Quaedvlieg N, et al. Identification of a light-regulated MYB gene from an Arabidopsis transcription factor gene collection. Plant Mol. Biol., 1996. 32(5): p. 987-93 [PMID:8980549] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]