PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi0380s00130.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 200aa MW: 22514.1 Da PI: 4.6365 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 102.7 | 5e-32 | 5 | 121 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 lppGf F+Ptdeel+ ++L +k++ ++ +i+++d+ ++Pw+L+ k+ ++ +e yfFs+++ +nr+t++gyWk+ g ++++ Vradi0380s00130.1 5 LPPGFCFSPTDEELLLHFLYPKTSLPCHPN--IIPDLDLSLHDPWHLNGKALSSGNEQYFFSRAK--------ENRSTENGYWKEIGLTEAI 86 79********************98776555..8**************977778899*****9974........5899*************** PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +s +e+vglkk Lvf g+ap+g++t+W+m+ey++ Vradi0380s00130.1 87 VS-ASEKVGLKKYLVFNLGEAPQGTETSWFMQEYHI 121 **.9999***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.32E-40 | 3 | 155 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 38.285 | 5 | 155 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.1E-19 | 6 | 121 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MSVNLPPGFC FSPTDEELLL HFLYPKTSLP CHPNIIPDLD LSLHDPWHLN GKALSSGNEQ 60 YFFSRAKENR STENGYWKEI GLTEAIVSAS EKVGLKKYLV FNLGEAPQGT ETSWFMQEYH 120 ICSSSFSTAS SGSTRGRRKS DQCRSKWVLC KAYEKKSCEG QQGVNCEKDE NDSGTELSWL 180 DEFYMSLDDD IEEVMSLPN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-31 | 3 | 157 | 15 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-31 | 3 | 157 | 15 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-31 | 3 | 157 | 15 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-31 | 3 | 157 | 15 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-31 | 3 | 157 | 18 | 170 | NAC domain-containing protein 19 |
3swm_B | 2e-31 | 3 | 157 | 18 | 170 | NAC domain-containing protein 19 |
3swm_C | 2e-31 | 3 | 157 | 18 | 170 | NAC domain-containing protein 19 |
3swm_D | 2e-31 | 3 | 157 | 18 | 170 | NAC domain-containing protein 19 |
3swp_A | 2e-31 | 3 | 157 | 18 | 170 | NAC domain-containing protein 19 |
3swp_B | 2e-31 | 3 | 157 | 18 | 170 | NAC domain-containing protein 19 |
3swp_C | 2e-31 | 3 | 157 | 18 | 170 | NAC domain-containing protein 19 |
3swp_D | 2e-31 | 3 | 157 | 18 | 170 | NAC domain-containing protein 19 |
4dul_A | 2e-31 | 3 | 157 | 15 | 167 | NAC domain-containing protein 19 |
4dul_B | 2e-31 | 3 | 157 | 15 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi0380s00130.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 1e-131 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014523778.2 | 1e-148 | NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 1e-53 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A1S3VZG8 | 1e-147 | A0A1S3VZG8_VIGRR; NAC domain-containing protein 104 | ||||
STRING | XP_007159851.1 | 1e-129 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1736 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 2e-54 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|