PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi0184s00090.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 124aa MW: 14524.4 Da PI: 10.3953 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.4 | 7.7e-19 | 16 | 61 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v+q+G +W++Ia++++ gR++k+c++rw++ Vradi0184s00090.1 16 RGHWRPAEDEKLRQLVEQYGAQNWNSIAEKLQ-GRSGKSCRLRWFNQ 61 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 62.7 | 7.6e-20 | 68 | 111 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++T+eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ Vradi0184s00090.1 68 RRPFTEEEEERLLAAHRIHGNK-WALIARLFP-GRTDNAVKNHWHV 111 679*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 19.997 | 11 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 9.36E-31 | 15 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.4E-15 | 15 | 64 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-28 | 17 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.74E-13 | 19 | 60 | No hit | No description |
Pfam | PF13921 | 3.6E-18 | 19 | 79 | No hit | No description |
PROSITE profile | PS51294 | 28.366 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 2.4E-16 | 67 | 115 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-22 | 70 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.69E-7 | 70 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
MEDSSAGEDP NKTCPRGHWR PAEDEKLRQL VEQYGAQNWN SIAEKLQGRS GKSCRLRWFN 60 QLDPRINRRP FTEEEEERLL AAHRIHGNKW ALIARLFPGR TDNAVKNHWH VIMARKQREQ 120 SKL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-33 | 16 | 116 | 7 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi0184s00090.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 1e-110 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014522324.1 | 1e-87 | transcription factor LAF1 | ||||
Swissprot | Q6R0C4 | 3e-67 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A1S3VW87 | 3e-86 | A0A1S3VW87_VIGRR; transcription factor LAF1 | ||||
STRING | GLYMA06G12691.1 | 2e-79 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF230 | 34 | 243 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17950.1 | 2e-65 | myb domain protein 52 |
Publications ? help Back to Top | |||
---|---|---|---|
|