PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi0169s00170.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 207aa MW: 23306.7 Da PI: 4.4734 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 58.8 | 1.1e-18 | 14 | 78 | 65 | 129 |
GRAS 65 ppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLl 129 +p+++++++ +e + + k +++++P+ kf+hltaN+aIlea++ ++ +Hi Df++ qG+QW+a l Vradi0169s00170.1 14 EPKSAKTTTLEELMLSCKDLNDACPYSKFAHLTANHAILEATKDASNIHIPDFGLVQGIQWVARL 78 5666666778888888888******************************************9866 PP | |||||||
2 | GRAS | 87.5 | 2.2e-27 | 84 | 196 | 186 | 301 |
GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277 ++dl+ +++ ++p+Eal+Vn++lql++llde+ + + + L+l ksl+Pk+v++ e ea++++ sF++rf a++y+sa+f+sl+ +l Vradi0169s00170.1 84 IHDLDRNNFCINPDEALVVNFMLQLYNLLDEPPTAVD---TALWLAKSLNPKIVTLDEYEASLTRVSFVNRFKTAFRYFSAVFESLDPNLVV 172 789999***********************99999888...**************************************************** PP GRAS 278 eseerikvErellgreivnvvace 301 +s er vE ll+r+i v+ Vradi0169s00170.1 173 DSPERFQVESLLLERRIDAVIELV 196 ******************999765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 15.674 | 1 | 206 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 3.9E-16 | 14 | 78 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 7.4E-25 | 84 | 196 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 207 aa Download sequence Send to blast |
MDKSSLLTLS YKGEPKSAKT TTLEELMLSC KDLNDACPYS KFAHLTANHA ILEATKDASN 60 IHIPDFGLVQ GIQWVARLSP LTPIHDLDRN NFCINPDEAL VVNFMLQLYN LLDEPPTAVD 120 TALWLAKSLN PKIVTLDEYE ASLTRVSFVN RFKTAFRYFS AVFESLDPNL VVDSPERFQV 180 ESLLLERRID AVIELVPVRE SMEDME* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5hyz_A | 3e-53 | 13 | 193 | 60 | 296 | GRAS family transcription factor containing protein, expressed |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development (By similarity). Involved in environmental abiotic stress resistance. May increase the expression of stress-responsive genes (PubMed:20616154). Binds DNA in vitro (By similarity). {ECO:0000250|UniProtKB:Q53K16, ECO:0000250|UniProtKB:Q9SCR0, ECO:0000269|PubMed:20616154}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi0169s00170.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by drought and high salt stresses, and down-regulated by gibberellic acid (GA) treatment, but not by plant hormone abscisic acid (ABA) application in leaves. Under the salt treatment, expression is induced quickly, and it peaks at 3 hours. Under the drought treatment, the expression is not induced immediately, but reaches its maximum at 3 hours. Under the GA treatment, the expression becomes weaker within 5 hours. {ECO:0000269|PubMed:20616154}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015039 | 1e-130 | AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014522771.1 | 1e-104 | scarecrow-like protein 4 isoform X2 | ||||
Swissprot | A0A024B7I0 | 1e-67 | SCL7_POPEU; SCARECROW-LIKE protein 7 | ||||
TrEMBL | A0A1S3VWK4 | 1e-103 | A0A1S3VWK4_VIGRR; scarecrow-like protein 4 isoform X2 | ||||
STRING | GLYMA12G02060.1 | 2e-89 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6280 | 34 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66770.1 | 1e-64 | GRAS family protein |