PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0025s0120.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family Nin-like
Protein Properties Length: 1439aa    MW: 147606 Da    PI: 7.4794
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0025s0120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK61.71.3e-1987135452
               RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           +sl +l++ ++lp k+AA++L+v+l+ LKr CR +++ RWPhRk++sl
  Vocar.0025s0120.1.p  87 ALSLTELQSVYHLPSKEAARSLNVSLSRLKRSCRAHNVLRWPHRKLSSL 135
                          699*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.80171155IPR003035RWP-RK domain
PfamPF020426.7E-1988135IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 1439 aa     Download sequence    Send to blast
MEAWALAAGE QNIQVTALAV DDRRHSLGGS TTTTTASRAM LIRQSPMEIS RGPSVGSASR  60
HSLGDVRDQF QSDDDEAEPG ADSLDDALSL TELQSVYHLP SKEAARSLNV SLSRLKRSCR  120
AHNVLRWPHR KLSSLSNLQE TIRNDKNMRL LDKQRILQQI VNEISAVRAN PDHTIDPRLD  180
EIRQAKYKLK YYHKTKHTLG SSSASSRKRR QSAPYPDQAL NLNLSAAAMA PISAVAAATA  240
NTTAYNGEGV SPPPPRQQQQ QQLLLSPSPW ASPGGRPGPE GGGPFATVSA PAAPAASLYT  300
ATVHAASASA AVFRGGGSGG SGGGGDSVDG QLAASFPSGS ALARFTSDRA SFGGSGFCLP  360
GVGGSVIDEM HLSRDGCSAH AVGGGIGSGC NSSSGGVGQV HRDMTMMGPM APVAAPSQRP  420
TQDSRLSEPG VGLPYGFPLS MQPGPAPLAG GTTAVSLNVQ HSQHQLQMLQ LQHGHRENHH  480
HYYAFQQQQQ WEQQQQQQLV GGLRRPSVGM MDETTGVVYP LPGMGPWGRK SGRLSDASMD  540
GVSSAPPAEG AAVATSVAPN HSAPSSSLWP SPPPPLPPQS ATSCQMQLSN PSPHLAQALG  600
SPPLSTGGVG GSATAAAATV TAAAALSAGP NSAGSVSGGA CAAESFPLGA CAAIAPHSGA  660
NNLSLSSSSS LAANGFAAFA GTFGGGNVDG GRASGGGARL GAPYSHGVVN TCCPPPRCSS  720
TGDPHIMAAA VAPPPGLAAM ALPRQVSAPP PMYGSVATGG GGGASAGGST CSGGGGFYGG  780
STTPMCGMPD GAARARFLST DGGYQEALGM PQPARSSHTG GGAVLSYSTT AATAAAGGVG  840
SHHTTLHFEA HVGISTVGSA ALASSSPPWF GIEARVRSGI VPPVAAAQAS AAMAPAPEDS  900
SRTATTAAAL ETHVYQEQQP LMQQQQMHMQ QQQMHMQHTQ GLRQAEQRHH HQQDCVSMQH  960
QHEQYQQQQR QHARQHPQYQ HKDLQREQHM HQQQQYQQQN QQARHLRQAY LHQQEQAQQK  1020
EQVRQQEQQQ GQARQQQIGH GHVHAGAQAQ QLVPSSASCM APLQMTAPKH QLQPLLQQAE  1080
WQQQQRPFPY VQQFGGSLDG GNSGSSPPAT ETGGFQNVPY KPYGMDGTAA RHSVVVKTGD  1140
GAAATIAAAV AKPPLLNAAG TDVRMSSSTG GAAAALGWVG REESSPSAAA RGSGASDGCC  1200
GELPISAGGN SASGVAPNGH SVACGTSSTT FLPGRSVTTG VPMRAPSPLQ GRPGQYPQHT  1260
IADAMAYVGA SWRSPVRGSA GADGTCADAG GRAWSKPSAS VEAPEGLLSV QESSPPPQQE  1320
QQQQQQQALQ QPQQLQQPQQ VQLQQCYAAK LEPWGSSSDL FCPFPHDGAS PTVAAVAAAG  1380
APAPVPAPAA GPSAAGNTGG TGLGTACGRA ETAATGGDGC DADGSAGVML ASFDWLLE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1205210SRKRRQ
2689696GGRASGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002957545.10.0RWP-RK domain-containing transcription factor
TrEMBLD8UFT90.0D8UFT9_VOLCA; RWP-RK domain-containing transcription factor
STRINGXP_002957545.10.0(Volvox carteri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1161422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-12RWP-RK domain-containing protein