PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0014s0106.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family Nin-like
Protein Properties Length: 1884aa    MW: 192618 Da    PI: 6.9592
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0014s0106.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK62.19.8e-2017081756351
               RWP-RK    3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51  
                            ei+ + l+k ++lpi++AA  L++++TvLK+ CR++ ++RWP+Rk++s
  Vocar.0014s0106.2.p 1708 REITKSALRKVYHLPINEAAAALNIGVTVLKKYCRKFRVPRWPYRKLQS 1756
                           689********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.49516931777IPR003035RWP-RK domain
PfamPF020423.3E-1917101756IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 1884 aa     Download sequence    Send to blast
MNTGKGLKAR RKFHGLPNSL MRRASKTWLG PNKCTSKPAG RGTLLAPSLY FYYVDQFRQW  60
FTEYEPPSLK GTTLQEPLCS ARRRRACRRL MEDLAEVLTE FHPSTGKVPH LDTLSQAHLP  120
IARELPNNDS LRLEEYLSAG SFAVLDAALH SICESQATLP ETNAGSSAPS SYYHSHQDQN  180
ALTGQGTNPM LATRQGFTSG QLAASTTGQT LQQQTQQHQQ QQQEHQHRQA ADGGQAAASG  240
TGSSGLFPRQ MNPQLAQPPT PQQQQQQQPS QHQLQELQHQ HLHQHQHQHQ HQQHQQQQQQ  300
QLLQGTRTSP AQQPSAPAQQ PQQQHSLQNH QQQQQQHQQH QQQKRPSLAS GGAACSRGPS  360
RSESNSNGSN QISRDATVPP PHESSTGESG PRADSGPMEV QVARATGATA AAVVTTVAAG  420
AAGGGGGSGA SGSRGDGHVA SGPAAGPAGG ASDQTHPPPP PPEVSTPPAE GRKLREEEQR  480
DVEEFVNLAW NANYKQGDAV RLEFTGPNVG ARTTGRLMAA ATAQLMRRGV AAAQAGQITG  540
LNTSIRSAME RHLPVKRDKA HLGDKGTELL TEALRHITEQ LMSRGVDPRS IIENHSNGTP  600
PGGGGAATAV AAAAAAANGG AGGSKTSLGS IGDNSADTAG LKLPSPPPVA AGAMVGMPPP  660
GGAMDLIQLQ QQQQLQQQLQ LQMQMQQAPQ FQQLMLEATR EHHQPTGPMG STGGPPLVDY  720
GGFFSPTGET GPVGVPAAGG GVSDILQEAF RAFAAEQEAA AVAAAAAAAA AEGGDGSGGD  780
MGATATMMDF QAAAAAAASS VLPNAATAAV PLYQRTTCSV TMIDVGHDES ELSSPHAAAA  840
AAAAAAAAAA AGGTLLSEGM QGACGPPGFR SGQWIPTGRS MVGGKAATLP SSSSSLQTTA  900
SAAAAAAAAA AAALPHQQQQ QMLHHSAAAG CAAGGMMSSF GGPPTCISPP PGPETSDKRP  960
LSPSRFDTGS PHRLSNAMSI LRNRSADLGS LDMIMSNDYF MDGVDPLLND GRQPSIADKF  1020
LMYIDGGGHP GMQPGGLIGL ASGFPLGPIP SGTAGDAAAA AAAATAGGPQ RQLPAAGLHS  1080
SGAGGAGGSA SAAAVDVFQN PHMPQAAVDG TCGGDATPGG GGGGGGGGGG NCLMGQDPRM  1140
IVYDMDAMMR SQAPTAFGGG VGVTTSAKPQ SFCRPSDNTL NTGNGSHTRE PLPSVDGGGS  1200
PAAPFGSSFA FAMAQYGNCP AADGGGDVGS VDGLARITSA PPGVLGDESA FCPRMSSAHA  1260
HGLSMAHGKG MSYSVPYSHG QGHPLAMNSA PAIWTGLGDS NLGGMDVYSM EHMGMPAPPG  1320
SAVERQQQVR QLQQQQQLQL EQLQQEQQQQ QQQQLQQQQL QQHQHQQQQQ LFAQLFPGAQ  1380
QAVCGGGGGS AGGSSISISP STMMSPTGNS PVMHFMPTSF PPQRDDSGCL SIGHKAHMLP  1440
RISTAVGLPP HFQPPPSPPS VVRNMRGGCA AANSVRAGGG AAAAAAAGQA PARSPRSSAP  1500
GTPRSPRAPA TGTPRSRTKA GCTPLSAPSP GAVKAQLDEM MRVDPVAAAA AAAGGGSGMS  1560
ESLAAAAAAA AVAAVAAAPE AALAAAAAAG LIVAEDAGAA VDSPGASGGG NLRRSRREAR  1620
GARGSTLGTA RTGRGGRSRG TDDDDEDYAT DADEDALSSD DGDDEGGGGG GGAGRGGGGG  1680
GGGTTSGEGY VDEDSVLVVR AVRDGVRREI TKSALRKVYH LPINEAAAAL NIGVTVLKKY  1740
CRKFRVPRWP YRKLQSMAKL IESFERYKKN AFSNGDIEGA ADCQDVIDRL LKFREEVYDN  1800
PDKDIDESVK KLRQANFKIE YRQRQGQTQG APPSTLTRSS LNGETPGAAT GVGGAPSSHD  1860
LRRDFETLSV NAASAEVTEP PPA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002954587.10.0RWP-RK domain-containing transcription factor
TrEMBLD8U7F80.0D8U7F8_VOLCA; RWP-RK domain-containing transcription factor
STRINGXP_002954587.10.0(Volvox carteri)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.15e-20RWP-RK domain-containing protein