PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang11g06450.1

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

YABBY

Protein Properties

Length: 213aa MW: 23810.1 Da PI: 6.5973

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang11g06450.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	125.9	5.7e-39	36	176	23	170
YABBY 23 avsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvir 117 vsvP tslfk+vtvrCGhCt+ll vn++ +++ hl++s+ + ++ l+ + +++ + s+s++ + + +e+pr+p ++r Vang11g06450.1 36 QVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLVPSPTQFHLGHSFFSPSHNLLEEIPNPSPNFLMNQANLSASNEFSLPARTAADELPRPPIINR 130 69****************************************999866666555555555555555555444443335666777786555444 PP YABBY 118 PPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 + vP + ++eiqrik+ nPdi+hreafsaaaknWahfP+ihfgl Vang11g06450.1 131 -----RPVPLVEEK--RDEIQRIKSVNPDITHREAFSAAAKNWAHFPHIHFGL 176 .....447776665..9********************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	2.0E-38	36	176	IPR006780	YABBY protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 213 aa Download sequence Send to blast
MDDDTVVFFG MRESHRAYMS MDGDASDRIF LRSMDQVSVP CTSLFKTVTV RCGHCTNLLP 60 VNMRGLLVPS PTQFHLGHSF FSPSHNLLEE IPNPSPNFLM NQANLSASNE FSLPARTAAD 120 ELPRPPIINR RPVPLVEEKR DEIQRIKSVN PDITHREAFS AAAKNWAHFP HIHFGLMPDQ 180 TVKKTNVCQQ EGEEVLMKDG FYASANVGVS PY*

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269\|PubMed:10323860, ECO:0000269\|PubMed:10331982, ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:11812777, ECO:0000269\|PubMed:12417699, ECO:0000269\|PubMed:19837869, ECO:0000269\|PubMed:9878633, ECO:0000269\|Ref.3, ECO:0000269\|Ref.6}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang11g06450.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT146476	3e-91	BT146476.1 Lotus japonicus clone JCVI-FLLj-18N7 unknown mRNA.
GenBank	BT148410	3e-91	BT148410.1 Lotus japonicus clone JCVI-FLLj-6P15 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001344763.1	1e-114	YABBY protein FILa
Refseq	XP_028209668.1	1e-114	protein YABBY 4-like isoform X1
Swissprot	O22152	2e-53	YAB1_ARATH; Axial regulator YABBY 1
TrEMBL	A0A445G6I2	1e-112	A0A445G6I2_GLYSO; Protein YABBY 5 isoform A
TrEMBL	I1MUX5	1e-112	I1MUX5_SOYBN; Uncharacterized protein
STRING	GLYMA17G14710.1	1e-113	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2040	34	90

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45190.1	7e-51	YABBY family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Lian H,Li X,Liu Z,He Y HYL1 is required for establishment of stamen architecture with four microsporangia in Arabidopsis. J. Exp. Bot., 2013. 64(11): p. 3397-410 [PMID:23918970] Tameshige T, et al. Pattern dynamics in adaxial-abaxial specific gene expression are modulated by a plastid retrograde signal during Arabidopsis thaliana leaf development. PLoS Genet., 2013. 9(7): p. e1003655 [PMID:23935517] Boter M, et al. FILAMENTOUS FLOWER Is a Direct Target of JAZ3 and Modulates Responses to Jasmonate. Plant Cell, 2015. 27(11): p. 3160-74 [PMID:26530088] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Tanaka W,Toriba T,Hirano HY Three TOB1-related YABBY genes are required to maintain proper function of the spikelet and branch meristems in rice. New Phytol., 2017. 215(2): p. 825-839 [PMID:28556940] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187]