PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang05g00890.1 | ||||||||
Common Name | LR48_Vigan04g250300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 116aa MW: 12482.8 Da PI: 5.5298 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 67.4 | 4.7e-21 | 2 | 43 | 113 | 154 |
DUF702 113 avfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154 a+frcv+v+svdd+ +e+aYqt+v+igGhvf+GiLydqG+e+ Vang05g00890.1 2 AMFRCVQVRSVDDAVNEIAYQTSVNIGGHVFSGILYDQGPEQ 43 99**************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
TIGRFAMs | TIGR01624 | 2.3E-19 | 2 | 41 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Pfam | PF05142 | 3.1E-17 | 2 | 42 | IPR007818 | Protein of unknown function DUF702 |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
MAMFRCVQVR SVDDAVNEIA YQTSVNIGGH VFSGILYDQG PEQNYNINKG ESSTALVDEH 60 QNNSLGLVKN SSSRDSSGVT IASAGHGDPL FPPPPYPFPL ASFRPGMPYF TYPRS* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang05g00890.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 0.0 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017420508.1 | 2e-80 | PREDICTED: protein SHI RELATED SEQUENCE 3-like | ||||
TrEMBL | A0A0L9UHB6 | 5e-79 | A0A0L9UHB6_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3RA68 | 1e-79 | A0A0S3RA68_PHAAN; Uncharacterized protein | ||||
STRING | XP_007135936.1 | 2e-52 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF22692 | 3 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G75520.1 | 1e-15 | SHI-related sequence 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|